(data stored in ACNUC7421 zone)

EMBL: CP002293.PE236

CP002293.PE236       Location/Qualifiers
FT   CDS_pept        complement(273578..274696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0243"
FT                   /product="Alkanesulfonate monooxygenase"
FT                   /EC_number="1.14.14.5"
FT                   /note="KEGG: bcl:ABC3395 alkanesulfonate monooxygenase;
FT                   PFAM: Luciferase-like, subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73092"
FT                   /db_xref="GOA:A0A0F6BI41"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI41"
FT                   /inference="protein motif:PRIAM:1.14.14.5"
FT                   /protein_id="ADP73092.1"
FT                   /translation="MVEFITMAPTSGDSTLVGLANNSSKLNSWTGTDENAERPPTQEYI
FT                   KAIAQAAEKGGFSTLLLPTGTGCLDSLAVAANLIAYTSKLKFLFAIRPGFIAPTTFAKQ
FT                   FATVDYWSNGRALVNIVTGGSPVELASEGDYLDHDTRYKRTREYMQILKKLFTEESVDY
FT                   EGEFFTLKGASLFPKPVKTPPIYFGGASEIAKEVAAEEADVYMMWGETFENTKQRLEEM
FT                   KQRAAKHNRTLSYSVSFQVILGNTEEEAWEKANKLISKVSASILAKKEEMIVKGDSIGA
FT                   KRLHQLMESSKERNFQIGPNLWAGLTQVLSGNSIALVGTPEQIAERIVELVELGFDKVL
FT                   LRGFPHLETIEQLGELVIPKVREKLAQKQLVK"
     atggtcgaat ttatcacaat ggccccaaca tcaggagaca gtacacttgt tgggttagcc        60
     aataactcgt caaaactgaa tagctggaca ggaacagatg aaaatgcaga acgcccccct       120
     acccaagaat atattaaagc gattgcccag gctgctgaaa aaggcggatt ctcgacgctt       180
     ttactgccga ctggcacagg atgccttgat tctttagccg ttgctgccaa tttaatcgcc       240
     tatacaagca aattaaaatt cctatttgca atccgccctg gttttatcgc acctactacc       300
     tttgccaaac aatttgccac tgtggattat tggtcaaatg gaagagcctt ggtgaatatt       360
     gttaccggag gttcgccggt cgagttagcc agcgaagggg attatttaga tcatgatacc       420
     cgttataagc ggacacgcga atacatgcaa atattaaaaa aactatttac tgaagaaagc       480
     gttgattacg aaggggaatt ttttacatta aaaggcgcct cattatttcc aaaaccagta       540
     aaaacgccgc caatctattt tggcggggca tcagaaatcg ccaaagaagt cgcggcggaa       600
     gaagcggatg tttacatgat gtggggggaa acttttgaaa atacaaaaca aagacttgaa       660
     gaaatgaaac agagagcagc caaacataac cggacgctga gttatagcgt ttcgtttcaa       720
     gtcatcctcg ggaacacgga agaagaagca tgggaaaagg cgaacaagct gataagcaag       780
     gtgtcagcat ccatattagc caaaaaagag gaaatgattg tgaaaggaga ttctattggc       840
     gcaaaacgcc tgcatcaact tatggaaagc agcaaagaac gtaactttca aattggcccg       900
     aatttatggg cgggactgac tcaagtttta tccggaaatt ctattgccct tgtcggcact       960
     cctgagcaaa tcgctgaacg gattgtcgaa ctggtggaat taggattcga taaagtgttg      1020
     ttaagaggct tccctcattt ggaaacgatt gagcaattag gagagctagt cattccaaaa      1080
     gtgagagaaa aactcgcaca aaaacaactt gtcaaatga                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page