(data stored in ACNUC7421 zone)

EMBL: CP002293.PE240

CP002293.PE240       Location/Qualifiers
FT   CDS_pept        complement(277404..277940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0248"
FT                   /product="FMN reductase"
FT                   /note="KEGG: gym:GYMC10_0654 FMN reductase; TIGRFAM: FMN
FT                   reductase; PFAM: NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73096"
FT                   /db_xref="GOA:A0A0F6BI45"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR020048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI45"
FT                   /inference="protein motif:TFAM:TIGR03567"
FT                   /protein_id="ADP73096.1"
FT                   /translation="MSNVVIINGNPSLTSRLNGMIQYVEQRLAQAGIEIGHIRVAELPP
FT                   EDLIKAKFDSEAILHANKKVEEADGIIIASPVYKAAYTGVLKTYLDLLPQKGLSGKIIL
FT                   PLFIGGTIAHLLSIDYALKPVLSALGGRYILGGVYAVDTWITRNEQEGYSLSEELIHRL
FT                   DEAAAEFADLLQRKN"
     atgagcaacg tcgtcattat caacggaaat ccttctttga catccagact taacggaatg        60
     attcaatacg tcgaacaacg attggcgcaa gcaggcattg aaatcgggca catccgagtc       120
     gcggaattgc ccccggaaga tttaattaaa gcaaaattcg atagtgaagc cattttgcac       180
     gctaacaaaa aagtcgaaga agcagacggc atcattatcg cgagcccagt gtataaagcg       240
     gcgtacacag gagtattgaa gacatatctt gatttgcttc cgcaaaaagg gttgtcgggg       300
     aaaatcattc ttccgctgtt tatcggcggc acaatcgctc accttttgtc gattgactat       360
     gcattgaaac ctgtactatc cgcattggga ggcagatata tcctcggggg agtgtatgcg       420
     gtcgatacat ggatcacccg gaatgaacaa gaagggtata gcctgtccga agagctgatc       480
     catagattgg atgaggcagc tgccgaattc gctgatttac tccagcgaaa aaattaa          537
//

If you have problems or comments...

PBIL Back to PBIL home page