(data stored in ACNUC7421 zone)

EMBL: CP002293.PE241

CP002293.PE241       Location/Qualifiers
FT   CDS_pept        278452..279327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0249"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: gwc:GWCH70_3152 ROK
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73097"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI46"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ADP73097.1"
FT                   /translation="MYLGAIEAGGTKFVCAVGDRNGKIKERVMFPTTEPEETMRHVVEF
FT                   FRQYELEAIGIGSFGPIDLRPGSATYGYITSTPKQKWVNFNFVGEMKRHFSVPIGFDTD
FT                   VNAAALGERRWGAAKGLQSCIYITVGTGIGVGAIVEGSLLHGLMHPEMGHILVRRHPED
FT                   AFAGVCPYHGDCLEGMASGPAIEKRWGKKGAELAGRAEVWELEAFYLAQAIANYILILS
FT                   PEKVIIGGGVMKQKQLLPSIRRNVQELLNGYIQQEAVLHDIDQYIVLPGLGDNAGICGA
FT                   LALAEQALAP"
     gtgtatcttg gagcgattga agccggcggc acgaaatttg tgtgcgctgt cggggaccgg        60
     aatggaaaga taaaagagag agtgatgttt ccaacgacgg aaccggaaga aacgatgcgc       120
     catgttgtcg agttttttcg acaatatgaa ttagaggcca tcggcatcgg ttcgttcggc       180
     ccgattgatt tgcgccccgg cagtgcgaca tatggctata ttacgagcac gccgaaacaa       240
     aaatgggtga atttcaattt tgtcggcgaa atgaaacggc atttttccgt gccgatcggt       300
     tttgataccg atgtcaatgc ggcagcgctt ggggaacggc gctggggtgc cgcgaaaggg       360
     ctgcaaagct gcatttatat tactgtcgga acgggaattg gcgtcggggc gattgtggaa       420
     ggcagcttgc tccatggcct catgcatccg gaaatggggc acattctcgt ccgccgccat       480
     ccagaagatg catttgccgg cgtctgccca tatcatggag attgcttgga aggaatggcg       540
     tccggaccgg cgattgaaaa gcgctggggg aaaaaaggcg cggaactggc cggccgcgca       600
     gaagtttggg agttagaagc gttttatttg gcgcaggcga ttgccaacta cattttaatt       660
     ttatcgccgg aaaaagtgat tatcggcggc ggcgtcatga agcaaaaaca gctgttgcca       720
     agcatccgcc gcaacgttca ggaattgttg aacgggtaca ttcagcaaga agcagttttg       780
     catgatatcg atcaatatat tgtgcttcct ggtcttggcg ataatgccgg catctgcggg       840
     gcgctggctc tcgctgagca ggcgttggcg ccatga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page