(data stored in ACNUC7421 zone)

EMBL: CP002293.PE244

CP002293.PE244       Location/Qualifiers
FT   CDS_pept        280561..282189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0252"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="KEGG: gwc:GWCH70_3147 drug resistance transporter,
FT                   EmrB/QacA subfamily; TIGRFAM: drug resistance transporter,
FT                   EmrB/QacA subfamily; PFAM: major facilitator superfamily
FT                   MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73100"
FT                   /db_xref="GOA:A0A0F6BI49"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI49"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADP73100.1"
FT                   /translation="MEKENELAMQSSTIRHRNILITGLIIAMLFGALDGTIVGTAMPRI
FT                   VGELGGLRLMTWLTTAYMLTSTAVVPIAGKLADLLGRRVIYVTGLVIFMVGSALCGMAD
FT                   KMTELVIYRGLQGIGGGIMMPMAMIVIGDVFTGKERAKWQGVFGALYGLASVLGPQIGG
FT                   FIVDHLNWRWVFYINLPIGILATIFIAMGLSKYKAEGPVKFDLAGMFTMIVGVVSLLLA
FT                   LTFGGDKYEWASWQIVTLFAVALVFLTVFVFVEMKAEEPILPMHLFRHRTFIVLNGIGF
FT                   LMSVGMFGAIMFVPFFMQGVIGVSATQSGTIMTPMMITMIIGSIVGGRTVYKIGVKSQI
FT                   FIGMVIMAAGFSLLSTMGVDTSKWTATLYMIILGLGMGLVMPILTLALQESFPKSELGV
FT                   VTSSSQFFRSIGGTFGMTILGAVMNHRSSQLLDDRFMPVLQSLPAQAKGMADRFAHMIH
FT                   DDPQGLYSILFSPEVLEKIPPQMRETFVPILKQSLVDSLHSVFLFGLIFVIGGTALVFG
FT                   MKKIKLSDKQRPLQTSGKNEKLPQS"
     atggaaaaag aaaatgaatt agcaatgcaa tcgagcacca ttcgccatcg gaatatatta        60
     attacgggtc ttatcattgc catgcttttt ggggcattgg acggaacgat cgtcggaacg       120
     gcgatgccgc gcattgtcgg ggagctcggc gggttaagat tgatgacatg gctgacgacc       180
     gcttatatgc tcacatcaac ggcggttgtg ccgattgctg gaaaacttgc ggatttatta       240
     ggcagacggg tcatttatgt gacaggactc gtcattttta tggttggctc cgccctttgc       300
     ggcatggcgg ataaaatgac ggagctcgtc atttaccgcg ggctgcaagg aatcggcggg       360
     ggaattatga tgccgatggc catgatcgtc atcggggatg tgtttaccgg aaaagaacgc       420
     gcgaaatggc aaggagtttt tggggcgtta tacggccttg cctcggtatt aggcccgcaa       480
     atcggcggct ttatcgtcga tcatttgaat tggcgctggg tattttatat taatcttccg       540
     atcgggattt tagccaccat ttttattgcg atgggattga gcaaatataa agcggaaggg       600
     ccagtgaaat ttgatcttgc cggaatgttt acaatgattg tcggcgttgt cagcctgctt       660
     ttggcgctga catttggcgg agataagtac gaatgggcat catggcaaat cgtgacgctg       720
     tttgcggtgg cgcttgtctt tttaaccgtg tttgtattcg tggagatgaa agcagaagaa       780
     ccgattttgc cgatgcattt attccgtcac cgcaccttta tcgtgcttaa tggaattggc       840
     tttttaatga gtgtcggcat gtttggggcg attatgtttg ttccgttttt tatgcaagga       900
     gtgatcggag tgagtgcaac ccagtccggc acgattatga cgccgatgat gattacaatg       960
     attatcggca gtatcgttgg cggccggacg gtttataaaa tcggcgtaaa atcacaaata      1020
     ttcattggca tggtcattat ggcggccgga ttcagtttac taagcacgat gggcgtggat      1080
     acgtcgaaat ggacggccac gttgtatatg atcattttag ggcttggcat ggggttagtg      1140
     atgccgattt taacactcgc tttgcaagaa agttttccaa agtcggagct tggtgttgtc      1200
     acttcctcca gccagttttt ccgctcgatc ggcgggacgt tcggaatgac gattttaggt      1260
     gcggtgatga accatcgctc cagccagctt ttggatgacc gtttcatgcc agtgttgcag      1320
     tcgcttccag cgcaggcgaa aggcatggca gaccggttcg cccatatgat tcatgatgat      1380
     ccgcaagggc tttattccat tttgtttagc ccggaggtgc ttgagaaaat tccgccgcaa      1440
     atgcgggaga catttgtgcc gattttaaaa cagtcgctcg tcgattcgct tcattccgta      1500
     ttcctgtttg gtcttatttt tgtcatcggc ggaacggcgc ttgtatttgg gatgaagaaa      1560
     atcaagctgt ctgacaaaca acggccattg caaacaagtg gcaaaaacga aaaactgccg      1620
     cagagttga                                                              1629
//

If you have problems or comments...

PBIL Back to PBIL home page