(data stored in SCRATCH zone)

EMBL: CP002293.PE246

CP002293.PE246       Location/Qualifiers
FT   CDS_pept        complement(282710..284230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0254"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: gwc:GWCH70_3145
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73102"
FT                   /db_xref="GOA:A0A0F6BI51"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI51"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADP73102.1"
FT                   /translation="MIYAQPGQPGSLITFKKRYENFIGGKWVPPVDGEYFENISPVTGK
FT                   PYCEVPRSKAADIELALDAAHAAKDAWGRTSPAERARILNKIADRIEENLEMLAVAETW
FT                   ENGKPIRETLNADIPLAIDHFRYFAGCIRAEEGTLAEIDNDTVAYHFKEPLGVVGQIIP
FT                   WNFPLLMATWKLAPALAAGNCVVLKPAEQTPTSILVLMELIEDLLPPGVVNIVNGFGLE
FT                   AGKPLASSNRIAKIAFTGETTTGRLIMQYASQNIIPVTLELGGKSPNIFFEDVAAKDDE
FT                   FFDKAIEGFTLFALNQGEICTCPSRALIQESIYDQFIERALERVKQIKQGNPLDTETMI
FT                   GAQASSEQLEKILSYIDIGKQEGAELLIGGERNFLEGDLRDGYYVKPTVFKGHNKMRIF
FT                   QEEIFGPVVSVTTFKDVNEALEIANETLYGLGAGVWTRDINTAYRVGRGIQAGRVWTNC
FT                   YHIYPAHAAFGGYKLSGFGRETHKMMLEHYQQTKNLLVSYSPKKLGLF"
     atgatttacg ctcaacctgg gcagcctggt tcgctcatca ctttcaaaaa acgctatgaa        60
     aatttcattg gcggcaaatg ggttccgccg gtcgatggcg agtattttga aaacatctct       120
     ccagtcaccg ggaaacctta ttgtgaagtg ccgcgttcca aagcagcaga cattgagtta       180
     gcgttagacg ctgcccatgc cgcgaaagac gcgtggggcc gcacttcccc tgccgaacgc       240
     gcgcgaatcc tcaacaaaat cgccgaccgc atcgaagaaa acttggaaat gctcgctgtt       300
     gcggaaacat gggaaaacgg caagccgatt cgcgaaacgc tgaatgcgga cattccgctt       360
     gccatcgatc atttccgcta ttttgccggc tgcatccgcg cagaagaagg gacgttagcg       420
     gaaatcgaca atgatacagt cgcctatcac tttaaagaac cgcttggggt tgtcgggcaa       480
     atcatcccat ggaacttccc gcttttaatg gcaacttgga agctcgcgcc agcattagcc       540
     gcgggaaact gcgttgtcct gaaacctgca gaacaaacac caacttcgat cctcgtgctt       600
     atggaactca ttgaagattt gcttcctcca ggtgttgtca acatcgtcaa cggattcggc       660
     ttggaagccg gaaaaccgct cgcttcaagc aaccgcatcg cgaaaattgc attcaccggt       720
     gaaacgacaa cagggcgttt aattatgcaa tacgcatcgc aaaacattat cccagtaaca       780
     ttagagcttg gcggaaaatc gccgaacatt ttcttcgaag acgttgcggc aaaagatgat       840
     gaatttttcg ataaagccat tgaaggcttt acgctgttcg cgttaaacca aggtgaaata       900
     tgtacgtgcc cttcccgcgc tctcattcaa gaatcgattt acgaccaatt tatagagcgt       960
     gcgttagagc gcgttaaaca aataaaacaa ggcaacccgc tcgacacgga aacgatgatc      1020
     ggcgcccaag catcttcgga acaattggaa aaaatattat cgtacattga tatcggcaag      1080
     caagaaggtg ccgaattgct tatcggcgga gaacgcaact tcttagaagg agacttaaga      1140
     gacggctatt acgtgaaacc gacggttttc aaaggccata ataaaatgcg cattttccaa      1200
     gaagaaattt tcgggccggt tgtctccgtc acgacgttta aagatgtcaa cgaggcgttg      1260
     gagatcgcca acgaaacatt gtacggttta ggcgccggcg tctggacacg cgacattaac      1320
     accgcttatc gcgtcggacg cggcatccag gcaggacgcg tctggacaaa ctgctaccac      1380
     atctatcctg cgcacgcggc attcgggggc tataagttat ccggattcgg ccgtgaaacg      1440
     cataaaatga tgcttgaaca ttatcaacaa acgaaaaact tgcttgtcag ctattcaccg      1500
     aaaaaacttg ggctcttcta g                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page