(data stored in ACNUC7421 zone)

EMBL: CP002293.PE248

CP002293.PE248       Location/Qualifiers
FT   CDS_pept        285138..285593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0256"
FT                   /product="protein of unknown function DUF1284"
FT                   /note="PFAM: protein of unknown function DUF1284; KEGG:
FT                   gwc:GWCH70_3142 protein of unknown function DUF1284"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73104"
FT                   /db_xref="InterPro:IPR009702"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI53"
FT                   /inference="protein motif:PFAM:PF06935"
FT                   /protein_id="ADP73104.1"
FT                   /translation="MKPLRLRGHHLLCVHGFRGMGYSPAFVEKMREVVAKIRDEEQDFL
FT                   IQVVAALDDACMACPHHGETACQAAPDSNEHVLSMDQKVIRHLGIEENGVYLKSELVQR
FT                   TAQKVRPDDLDYLCANCSWLPYGVCKEGIANVQRGNVAQKIEEDGRR"
     atgaagccgc tgcggttgcg aggccatcat ttattatgtg tccatggatt tcgcgggatg        60
     ggatacagcc cggcgtttgt cgaaaaaatg cgggaagtgg tggcgaaaat tcgcgatgaa       120
     gagcaagatt ttctgatcca agtcgtggcc gcgctcgacg atgcgtgcat ggcgtgtccg       180
     catcacgggg aaacggcatg ccaggcggcc ccggattcga acgaacatgt cctttcgatg       240
     gatcaaaaag tgatccgtca tttaggaatt gaagaaaacg gcgtttattt aaaatcggaa       300
     ttagtgcagc ggacagcgca aaaagtgcgc ccggatgatt tggactactt atgcgccaac       360
     tgttcgtggc ttccgtacgg cgtatgtaaa gaaggaattg cgaatgtgca acgcggcaat       420
     gtcgcgcaaa aaattgagga ggatggccgg cgttga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page