(data stored in SCRATCH zone)

EMBL: CP002293.PE249

CP002293.PE249       Location/Qualifiers
FT   CDS_pept        285541..285699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0257"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: vap:Vapar_0593 PAS/PAC sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73105"
FT                   /db_xref="GOA:A0A0F6BI54"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI54"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0593"
FT                   /protein_id="ADP73105.1"
FT                   /translation="MCNAAMSRKKLRRMAGVDAAVVRTIGTVAILLSEFIKNNDAIYEK
FT                   VWYDRQI"
     atgtgcaacg cggcaatgtc gcgcaaaaaa ttgaggagga tggccggcgt tgacgcggcg        60
     gtggttcgca ccattggcac cgtagcaata ttgttgtcag aattcatcaa aaataatgac       120
     gccatttatg aaaaagtgtg gtatgataga caaatataa                              159
//

If you have problems or comments...

PBIL Back to PBIL home page