(data stored in ACNUC7421 zone)

EMBL: CP002293.PE250

CP002293.PE250       Location/Qualifiers
FT   CDS_pept        285732..287108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0258"
FT                   /product="aspartate kinase"
FT                   /note="KEGG: gwc:GWCH70_3141 aspartate kinase; TIGRFAM:
FT                   aspartate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73106"
FT                   /db_xref="GOA:A0A0F6BI55"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR035804"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI55"
FT                   /inference="protein motif:TFAM:TIGR00657"
FT                   /protein_id="ADP73106.1"
FT                   /translation="MKVAKFGGSSVASATQFRKVAHIINSDVERRIIVVSAPGKRFKDD
FT                   IKITDILIQLAQAVMAGKTCDEIVQAVVKRYAEIAKELELPADEFLAELKNDLHRKMNE
FT                   YRDNPSRLLDAIKASGEDHNARLMALYLQEIGLEASYVSPREAGIVVTDEPGNAQILPE
FT                   SYEKLYHLRNRRGVLVIPGFFGYSPEGNIVTFPRGGSDITGSIVAAGVKADVYENFTDV
FT                   DSIYCVNPSIVENPRQLREITYREMRELSYSGFSVFHDEALEPVYKAGIPVCVKNTNNP
FT                   AAPGTWIVAKRNHLDEPIAGIASDTGFCSINISKYLMNREIGFGRKLLQILEDEGISYE
FT                   HAPSGIDNMSVILRANQLKEGKEQRILARIQAELKVDEVHIEHGLALIMVVGEGMERAV
FT                   GMAAKATTALAQANINLEMINQGSSEVSMMFGVKEEAVVDAVRALYQAYFQEAVVGNEV
FT                   "
     atgaaagtag caaaatttgg cggaagctcg gttgcaagcg ccacgcagtt ccggaaagta        60
     gctcatatca tcaactctga cgtggagcgc cgcattattg tcgtgtcagc tcccggaaag       120
     cgatttaaag atgacataaa aataaccgat attcttatcc agttggcgca agctgtcatg       180
     gccggaaaaa cgtgtgacga aatcgtccaa gcggtagtaa agcgatatgc ggaaatcgcc       240
     aaggaactcg aattgccggc agacgagttt ttggcagaat tgaaaaacga cttgcaccgg       300
     aaaatgaacg aataccgcga taatccaagc cgtttgctgg atgccatcaa agcgagcggg       360
     gaagaccata atgcgcgatt gatggcgctt tatttgcagg agatcgggct ggaggcaagc       420
     tatgtcagcc cgcgggaagc gggaattgtc gttacggatg aaccggggaa tgcgcaaatt       480
     ttgccggaat cgtatgaaaa gctttaccat ttgcgaaacc ggcgcggtgt gttagtgatt       540
     cccggctttt tcggctactc gccggaaggg aatattgtca cattcccgcg cggcggttcg       600
     gatatcaccg gatcgattgt ggcagccggg gtgaaagcgg acgtatatga aaactttacg       660
     gacgtcgatt cgatttattg cgtcaatcct tccattgtcg aaaatccgcg ccagttaaga       720
     gaaattacat accgggaaat gcgcgagctt tcgtattcgg ggttttccgt gtttcatgac       780
     gaagcgctgg aaccggttta taaagcgggc attcctgttt gtgtgaaaaa tacgaataac       840
     cccgctgccc caggcacttg gattgtcgca aaacgaaacc atctcgacga accgattgcc       900
     ggcatcgcca gcgatacggg attttgcagc attaacatca gcaaatattt aatgaacagg       960
     gaaatcggct ttgggcgaaa attattgcaa attttagagg atgaaggcat ttcgtatgaa      1020
     catgctccgt ccggcattga caacatgtct gtgattttgc gggcaaacca attgaaagaa      1080
     ggaaaagaac aacgcatttt agcccgcatt caagcagagc tgaaagtcga cgaagttcat      1140
     attgagcacg ggcttgcgct gatcatggtc gtcggcgaag ggatggagcg cgccgtcggg      1200
     atggcggcaa aggcgactac ggcgcttgcg caggcaaaca ttaacctcga aatgatcaac      1260
     caaggttcat cggaagttag catgatgttc ggtgtcaagg aagaagccgt agtcgatgcg      1320
     gtgcgcgcgc tctaccaggc gtattttcaa gaagcagtgg tgggaaacga agtttaa         1377
//

If you have problems or comments...

PBIL Back to PBIL home page