(data stored in ACNUC7421 zone)

EMBL: CP002293.PE251

CP002293.PE251       Location/Qualifiers
FT   CDS_pept        287321..288286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0259"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73107"
FT                   /db_xref="GOA:A0A0F6BI56"
FT                   /db_xref="InterPro:IPR030832"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI56"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3140"
FT                   /protein_id="ADP73107.1"
FT                   /translation="MKRFCIAIITCFFFATAHGAAPAFAQVDKRELEQYLSSIGWTMND
FT                   LLNYLDHYHMTVADFQTMAELKQWLGTPIAEENFQQLLKRYQLTQEELEALLGQFGETV
FT                   QDYTFIEDLDAAVAFYLRHNGQMQQINDMLGAIGFTEKEANRLFEHVAALHRQNLPQQL
FT                   EALTARMKPFLQVEDAALLTKQQQQQLLSIWEDVLSVLQIKPKFYLLENGKKQEVSYRR
FT                   LLSLHTLGGRDLLIELYNQKGELLSDVQLSEEILASGYVFRAGEKFIHASMLASEMKET
FT                   MRGDKMPDTASPYLANALLGLLLALFGVYVFWRAKSKAVE"
     atgaaacgat tttgcattgc catcattaca tgtttctttt ttgccaccgc ccacggagcc        60
     gcgcccgcat ttgcgcaagt cgacaagcgg gagcttgaac agtacctcag cagcatcggc       120
     tggacaatga atgatttgct aaactatttg gaccattatc atatgacggt cgcggatttt       180
     cagacgatgg ccgaacttaa gcaatggctc ggcacaccga ttgcagaaga aaatttccag       240
     cagttgctca agcgctatca attgacacag gaagaattgg aagcattgct cggccagttt       300
     ggcgaaacgg tgcaagatta tacatttatt gaagacttgg atgcggccgt cgccttttat       360
     ttgcgccata acggacaaat gcagcaaatt aacgatatgc ttggagcgat tggctttacg       420
     gaaaaggaag cgaatcgttt atttgagcat gttgccgcgc tccatcgcca aaatttgccg       480
     cagcagctgg aagcgttaac cgcgcgcatg aaaccgtttc tgcaggtgga agacgcggcg       540
     ctgctgacga aacagcaaca acagcaattg ctttccattt gggaagatgt gctgtctgtg       600
     ctgcaaataa aaccgaaatt ttatttgctg gaaaacggga aaaaacagga agtgtcttac       660
     cgccggcttc tgtcgctaca tacgcttggc gggcgcgatt tattgattga actgtacaac       720
     caaaaaggag aattgctttc agatgtgcag ttatcggagg agatactggc ttcgggatac       780
     gtgttccggg cgggggaaaa attcatccat gccagcatgc tggcaagtga aatgaaagag       840
     acaatgcgcg gcgacaaaat gccggatacc gcttctccgt atcttgccaa tgcgctgctc       900
     ggccttttgc ttgctttgtt cggcgtttat gtgttttggc gggccaaaag caaagcggtg       960
     gagtga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page