(data stored in ACNUC7421 zone)

EMBL: CP002293.PE252

CP002293.PE252       Location/Qualifiers
FT   CDS_pept        288292..288900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0260"
FT                   /product="sortase family protein"
FT                   /note="KEGG: gwc:GWCH70_3139 sortase family protein;
FT                   TIGRFAM: sortase family protein; PFAM: peptidase C60
FT                   sortase A and B"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73108"
FT                   /db_xref="GOA:A0A0F6BI57"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR041999"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI57"
FT                   /inference="protein motif:TFAM:TIGR01076"
FT                   /protein_id="ADP73108.1"
FT                   /translation="MGERWETYKMRGAVLCMAAGLITAVWNGYSYWLGYNAVKPWKEER
FT                   KTPIAPQAADWQTAGTAAKPKIGDQIGTLLIPKLGISIPIYHGTETQQLRKGIGHYPKS
FT                   ALPGETNNMVLSGHRDTVFWQLGQIGIGDKLIVETAAKQFVYRVKKVRIVGENNRTVLV
FT                   EKPRPTLTVTTCYPFRFIGKAKQRYVLVAQLVSTIKKTG"
     atgggagaaa gatgggaaac atataaaatg cggggcgccg ttttatgcat ggcggcagga        60
     ttaataacag cggtttggaa tggatattcg tactggctcg ggtacaatgc cgtaaaacca       120
     tggaaagagg aaagaaaaac gcccattgct ccgcaagcgg ctgattggca aacggcaggc       180
     accgccgcga agccaaagat tggcgaccaa atcgggacgt tgttgattcc aaaactcggt       240
     atttccatcc cgatttatca cggcacggaa acgcagcaat tgcggaaagg aatcggccac       300
     tacccgaaaa gcgctttgcc gggggaaacg aacaacatgg tgctgtcggg gcaccgtgat       360
     acggtatttt ggcaattggg gcaaatcggc attggcgaca aattgatcgt ggaaacagcg       420
     gcaaagcagt ttgtttatcg cgtgaaaaaa gtgcgcatcg tcggtgaaaa caaccgcacc       480
     gtccttgtcg aaaagccgcg cccgacatta acggtgacga catgttatcc gttccgcttt       540
     attggcaagg cgaagcagcg ctatgttctt gtggcgcagc ttgtttccac cataaagaaa       600
     acgggctag                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page