(data stored in ACNUC7421 zone)

EMBL: CP002293.PE253

CP002293.PE253       Location/Qualifiers
FT   CDS_pept        complement(288919..289371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0261"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73109"
FT                   /db_xref="InterPro:IPR025573"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI58"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3138"
FT                   /protein_id="ADP73109.1"
FT                   /translation="MKTFKLVGLSVVHDDLHRQEIPFIDGLIINKEDGQNHWLIETYLD
FT                   KQYEPIFSELQKRNDEFRLQVTITNRSNDPANMIATVRSITRMNNHISVLMDGLLVRSK
FT                   TDLAEVVLASLVEKGLQGEALLKEFKRQLNERRGFKNNEEKTRIQQ"
     atgaaaacct tcaagcttgt ggggctctcc gtcgttcacg acgatttgca ccgtcaagaa        60
     attccattca ttgacggact tattattaat aaagaagatg gacaaaacca ctggctaatt       120
     gagacatatt tagataaaca atacgagccg atcttttccg agctgcaaaa aagaaacgat       180
     gaattccgcc ttcaagtaac gataaccaac cgaagtaacg atcccgccaa catgatcgcg       240
     accgttcgtt ccatcacaag aatgaacaac catataagtg tgcttatgga tggcttgtta       300
     gtccggagca aaacggattt agcagaagtg gtgctcgcga gccttgtcga aaaagggctg       360
     caaggagaag cgctattgaa ggaattcaaa cggcaattga acgagcgccg cggcttcaaa       420
     aataatgaag aaaaaacgcg aattcaacaa taa                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page