(data stored in ACNUC7421 zone)

EMBL: CP002293.PE255

CP002293.PE255       Location/Qualifiers
FT   CDS_pept        complement(290175..290594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0263"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: gwc:GWCH70_3135 transcriptional regulator, XRE
FT                   family; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73111"
FT                   /db_xref="GOA:A0A0F6BI60"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI60"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADP73111.1"
FT                   /translation="MKKMRKLGEKLKYLRKQHNWTQEQLAQHLNISRSQISKWENGELL
FT                   PDVQSLEKLSNLYEVSIDFLIGKHTTKKELLREMNLLYQTDRIDEKMLDIIDYFKQNPD
FT                   MEEMIYSLAQLPAKKRKHLETIIITLIQEFSDAVK"
     gtgaagaaaa tgaggaaatt aggagaaaaa ctaaaatatt tgcgcaagca gcataactgg        60
     acgcaagagc agctggcgca gcatctcaat atatcgcgct cgcaaatcag caaatgggaa       120
     aacggagaat tgctcccgga cgtgcaatca ttggaaaaat taagcaacct ttacgaagtg       180
     agcatcgatt ttttaatcgg gaagcatacg acgaaaaaag agcttctgcg ggaaatgaac       240
     cttttatatc aaacggaccg cattgatgaa aaaatgctcg atattatcga ctatttcaaa       300
     caaaacccgg atatggaaga aatgatttat tcgctggccc aactgccggc gaaaaaacga       360
     aaacatttgg aaacgatcat tattacgctg atacaagaat tttccgacgc agtgaaataa       420
//

If you have problems or comments...

PBIL Back to PBIL home page