(data stored in ACNUC7421 zone)

EMBL: CP002293.PE259

CP002293.PE259       Location/Qualifiers
FT   CDS_pept        293702..294847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0267"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine 2-epimerase; KEGG:
FT                   gwc:GWCH70_3132 UDP-N-acetylglucosamine 2-epimerase; PFAM:
FT                   UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73115"
FT                   /db_xref="GOA:A0A0F6BI64"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI64"
FT                   /inference="protein motif:TFAM:TIGR00236"
FT                   /protein_id="ADP73115.1"
FT                   /translation="MADKIKVMTIFGTRPEAIKMAPLVLELKKHPELIEPIVTVTAQHR
FT                   QMLDQVLEIFNIKPDYDLNIMKDRQTLSEITIRSLAGLDDVMKKVKPDLVLVHGDTTTT
FT                   FVASLAAFYNQIAVGHVEAGLRTWNKYSPFPEEMNRQLTGVIADLHFAPTKKAYENLIR
FT                   ENKKPDSIFITGNTAIDALKTTVTDNYKHDILEKIGDDRMILLTAHRRENLGESMRNMF
FT                   RAIKRIVQEHEDVQVVYPVHLNPAVREVADEILGNDPRIHLIEPLGVFDFHNLAARAFL
FT                   ILTDSGGVQEEAPSLGVPVLVLRDTTERPEGIEAGTLKLAGTNEETIYSMARELLNNRS
FT                   EYEKMAKASNPYGDGQASKRIVQAILYYFGKATQPPEPFSV"
     atggctgata aaataaaagt tatgacgatt tttggcacaa gaccggaagc tataaaaatg        60
     gcgccgcttg tgttggagct gaaaaaacat ccggagctga tcgagccaat tgtcaccgtc       120
     acggcgcagc accggcaaat gctcgatcaa gtgctggaaa ttttcaatat aaagccggat       180
     tatgacttaa atattatgaa agaccgccaa acgttatcag aaattactat acgctcttta       240
     gcagggctcg acgatgtgat gaaaaaggta aaaccggatt tggtgctagt gcacggggat       300
     acgacgacaa cgtttgtcgc cagccttgcc gcgttttaca atcagattgc tgtcgggcat       360
     gtcgaagccg gtttgcgcac atggaacaaa tattcaccgt ttccagaaga aatgaaccgc       420
     cagcttaccg gcgtgatcgc cgatcttcat tttgcgccga cgaaaaaagc gtatgaaaac       480
     ttaatccgtg aaaataaaaa gcctgactcg atttttatta cgggaaatac ggcgatcgac       540
     gcgttaaaaa caacggtgac agacaactat aagcatgata ttttagagaa aatcggcgat       600
     gatcgcatga ttttattaac cgcccatcgc cgggaaaatc ttggcgaatc gatgcgcaac       660
     atgttccgcg cgatcaagcg cattgtccaa gaacatgaag atgtgcaagt cgtttatcct       720
     gtccatttaa acccggcggt gcgcgaagta gctgatgaaa ttcttggcaa tgatccgcgc       780
     attcatttga tcgagccttt aggggtgttt gactttcata atctcgccgc gagggcgttt       840
     ctcattttga ccgattccgg cggcgtgcag gaagaagcgc cttcattggg tgtgccggtg       900
     ttggtgctgc gcgacacgac agaacggccg gaaggcatcg aggcggggac gctgaaatta       960
     gcgggaacga atgaagaaac gatatacagc atggcccgcg agctgttgaa taaccgcagc      1020
     gaatatgaaa aaatggcgaa agcctcgaac ccgtacggag acggccaggc ttccaagcgc      1080
     atcgtgcagg cgattcttta ttattttggc aaggccacac agccgcctga accattttcc      1140
     gtttaa                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page