(data stored in ACNUC7421 zone)

EMBL: CP002293.PE26

CP002293.PE26        Location/Qualifiers
FT   CDS_pept        39919..40551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0026"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="TIGRFAM: thymidylate kinase; KEGG: gwc:GWCH70_0026
FT                   thymidylate kinase; PFAM: thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72882"
FT                   /db_xref="GOA:A0A0F6BHI1"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHI1"
FT                   /inference="protein motif:TFAM:TIGR00041"
FT                   /protein_id="ADP72882.1"
FT                   /translation="MKGRFFSFEGPEGAGKTTMIAMLESFLREKGFDVLATREPGGVRI
FT                   AEEIRSIILNPAHTEMDGRTEALLYAAARRQHLLEKIIPAVKSGKIVLCDRFIDSSLAY
FT                   QGFARELGMDEILQINQFAIDGYFPTLTIYFDIDPKMGLERIQKNKQREMNRLDMENLS
FT                   FHYKVREGYLKLAKRFSDRIITIDASKSVDEVFAMTVAAIMDRIGER"
     atgaaaggcc gttttttttc tttcgaaggg ccggaaggag caggaaaaac gacgatgatt        60
     gctatgctgg aatcgttttt gcgggaaaaa gggtttgacg ttttagcgac aagagaaccg       120
     ggaggtgttc gtattgccga ggaaattcgc tccattattt taaatccggc acacacggaa       180
     atggatggcc gcacggaagc gctcctttac gccgctgcga gaaggcagca tcttttagaa       240
     aaaattattc ctgcggtaaa atccggtaaa atcgtattgt gcgatcggtt tattgacagc       300
     tctttagctt atcaaggatt tgcgagggaa ttagggatgg atgaaatatt acaaattaat       360
     cagtttgcta ttgatggcta ttttccgacg ttgactattt attttgatat tgaccctaaa       420
     atgggattag agagaattca aaaaaacaag cagcgcgaaa tgaaccggct tgatatggaa       480
     aatttgtctt tccattataa ggtaagagaa ggatatttaa agttagctaa acggttctct       540
     gaccgcatca ttaccattga tgcttccaaa tcggttgatg aagtgtttgc aatgaccgta       600
     gcggcaataa tggaccgaat aggagaaaga tag                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page