(data stored in SCRATCH zone)

EMBL: CP002293.PE260

CP002293.PE260       Location/Qualifiers
FT   CDS_pept        294979..295386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afl:Aflv_2676 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73116"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI65"
FT                   /inference="similar to AA sequence:KEGG:Aflv_2676"
FT                   /protein_id="ADP73116.1"
FT                   /translation="MLKDLPHAVKVGITRSITRTFEAYMRDIEWNEQRFDPQVFMQRWR
FT                   NDIVRHSSWFHSLDDRLKANSVFHQELADKINSVIDKVLSEAPTEEQLAKIKELATLHG
FT                   EKDIPVSCKAEANYHIERLERLGNMDKTENK"
     atgttgaaag atcttccaca tgctgttaaa gtcgggataa cgcgttccat tactcggaca        60
     tttgaagcat acatgcggga cattgaatgg aatgaacaac gatttgaccc gcaagtattt       120
     atgcaacggt ggcgcaatga cattgtgcgc cattcaagct ggtttcattc tcttgatgat       180
     cgcttgaaag caaattcagt gtttcatcag gaattggccg acaaaattaa ttccgttatt       240
     gataaagtgc tgtcagaagc gccgaccgag gagcaactgg ctaaaattaa ggaattggca       300
     acgctgcatg gcgaaaaaga cattcccgtt tcctgcaaag cggaagcaaa ttatcacatt       360
     gaacgtctcg agcgtctcgg gaatatggac aaaacagaaa ataaatga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page