(data stored in SCRATCH zone)

EMBL: CP002293.PE263

CP002293.PE263       Location/Qualifiers
FT   CDS_pept        297691..299208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0271"
FT                   /product="virulence factor MVIN family protein"
FT                   /note="PFAM: virulence factor MVIN family protein; KEGG:
FT                   bmq:BMQ_5225 integral membrane protein MviN"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73119"
FT                   /db_xref="GOA:A0A0F6BI68"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI68"
FT                   /inference="protein motif:PFAM:PF03023"
FT                   /protein_id="ADP73119.1"
FT                   /translation="MSKLRIASILFLLSTFFLKFSSMFRDIIIAKLFGNSYVTDAYIAA
FT                   MTIPNALILFMLTGMKDAFLPSYYKYSQLGKGFSHLTNIVKGTFWISFVISVAGALLSP
FT                   LFIPKLYPDFNNHGTQIAIWTAVIYFLSVAIVGVNAVYEGYFDAQKMFSFSTFSQTIVV
FT                   LCTIGGALFLHRPMGIYSVPFGYFVGTVFSFLIKLFYLGPRRFIDWKQPMDREEVISFY
FT                   RIFLPIGLTIAVGQVNLFVNTLFAARLGEGAVSTLNYAFRLVSIPQAIFGVTIATIVFP
FT                   LLAEAKAKNDMALFKAGIEKGLTYMFLFLAPTVAGMLVLMKECVQIVYERGAFTASATA
FT                   QTSEYAFLYIGSVLFYSIQAVIAKGFYTLEKGHYMLRAGIVSIIANIIFNAIFSSMIGA
FT                   AGLALSASFVGLVYSLITFTTLYKITGGFRLSVVGKEYGKITISTLAMVAVLLFVKYEL
FT                   HADRLAIIPYLAFMIVLGAAVYFVALWVFKVESVKEILTKKRRKEVS"
     atgtccaaat tacgcattgc gagcatcttg tttttgctat ccaccttttt tctgaaattc        60
     tcgagcatgt ttcgcgatat catcatcgcc aagttattcg gtaactctta tgttaccgat       120
     gcttatatcg cggcgatgac catcccgaat gcacttattt tgtttatgtt gacggggatg       180
     aaagacgcct ttttgcctag ctattataag tattctcagc taggaaaagg cttttctcat       240
     ttaacgaaca tcgtaaaagg aacattttgg atttcgtttg ttatctcggt cgccggagcg       300
     cttctttctc cgcttttcat tccaaagttg tatccggatt ttaataacca tgggacgcaa       360
     attgctatat ggacggcggt catttatttt ctgtcagtgg cgattgtcgg tgtcaatgcc       420
     gtttatgagg ggtattttga tgcccaaaag atgttttcgt tttcgacatt ttcccaaacg       480
     attgttgtgc tatgcacaat tggcggtgca ctgtttcttc atcgcccaat ggggatttat       540
     tccgtgccgt ttggctattt tgtcggaacc gttttttctt tcttaataaa gctgttttat       600
     ttaggaccgc gccggtttat tgactggaag cagccgatgg atcgggaaga agttatctcg       660
     ttttaccgca tctttttgcc aatcgggcta acgatcgctg tcggccaagt aaacttattt       720
     gtgaatacat tgtttgccgc aaggcttggc gaaggggccg tatctactct aaactatgca       780
     ttccgtctcg taagtattcc gcaggcgatt tttggcgtga ccattgccac gattgtgttt       840
     ccgctgttag cggaggcaaa agcaaaaaac gatatggcgc tgtttaaagc cggcatcgaa       900
     aaggggctta cgtacatgtt tttatttttg gcgccgactg tcgccggaat gctcgtattg       960
     atgaaagagt gcgtccagat tgtatatgaa cggggcgcgt ttacggcgag tgcgaccgcc      1020
     caaacaagcg aatacgcttt tttgtatatc ggttctgtgc ttttttacag catccaagcc      1080
     gtcattgcga aaggatttta tacgctggaa aaagggcatt atatgctgcg agccggaatt      1140
     gtttcgatta ttgctaacat tatttttaat gcgatttttt ccagcatgat aggggcggcg      1200
     ggtctggctt tatccgcgtc ttttgtcggg ttagtgtatt cgctgattac gtttacgaca      1260
     ctttataaaa tcacaggtgg atttcgtctt tcggtagttg gaaaggagta cgggaaaatt      1320
     accattagta cgctcgcaat ggtagctgtg ttgctttttg taaaatacga attgcatgcc      1380
     gatcggctcg ctatcatccc gtatttagca ttcatgattg tgctgggggc agcggtatac      1440
     tttgtggcat tatgggtgtt caaggtggag tccgttaaag aaattttaac aaaaaagagg      1500
     aggaaagaag tttcttag                                                    1518
//

If you have problems or comments...

PBIL Back to PBIL home page