(data stored in SCRATCH zone)

EMBL: CP002293.PE265

CP002293.PE265       Location/Qualifiers
FT   CDS_pept        complement(300758..301657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0273"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73121"
FT                   /db_xref="InterPro:IPR030910"
FT                   /db_xref="InterPro:IPR030911"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI70"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3048"
FT                   /protein_id="ADP73121.1"
FT                   /translation="MFPFFKKQKQQKDEHDSVVEANELSENSEADSDEEEVKTELSFHP
FT                   SWNVSIEERYYYQFLHNQQRPLKKNQISLSGIDLKQVPRGYVVTAFVRNSLSRPVAFTP
FT                   APLLLLGPNNEVLARKVFDLSELGEVPPRSSRPWKFLFEQETLRTSELPLVDWKLAFEL
FT                   PKQKHHSLDLAESWEKSLAAEDKQKLQALVQSLQPPKPGEVNFMGLQAQQTEQGDLHVT
FT                   LLIRNGSDKNIHIEQLALQVHDASGDIVASGAFSLDHFEVKANTSKPWTFIFPKSLVTK
FT                   ENPDLRSWKVSLPSSQPS"
     atgtttccat tttttaaaaa acaaaaacag caaaaagacg aacatgacag cgtcgtagaa        60
     gcaaacgaac tgtcagaaaa cagcgaggca gattcggacg aagaagaagt caaaacagag       120
     ctgtcgttcc atccatcgtg gaacgtaagc atagaagaac gttactatta tcaatttttg       180
     cataatcagc agcggccgct gaaaaaaaac caaatttctt tatccggcat tgatctaaaa       240
     caagtgccgc gagggtatgt cgttacggct ttcgtccgca acagcttgtc ccgtccggtt       300
     gcattcaccc cggctccgct tttgttgctc ggcccgaaca atgaagtgct cgcccgtaaa       360
     gtgttcgact tgtcggaact tggggaagtc ccgccgcgta gcagccgccc atggaaattt       420
     ttatttgaac aagaaacgct cagaacttct gaactgccac tcgttgattg gaagcttgcc       480
     tttgaattgc caaaacaaaa acatcactcc ctcgatttag cagaaagctg ggagaaaagc       540
     ttggcggcag aggacaaaca aaagctgcag gcgctcgttc aatcgctgca gccgcctaaa       600
     ccaggggaag tcaattttat ggggctgcaa gcgcagcaga cagaacaagg cgatcttcat       660
     gttacgctgc ttattcgcaa tggaagtgac aaaaacattc atattgaaca attagcgctg       720
     caagtccatg atgcaagcgg agatatcgtc gccagcggcg cattttccct tgatcatttt       780
     gaagtgaaag caaatacaag caaaccgtgg acgtttattt tcccaaaatc gctagtcacg       840
     aaggaaaatc cggatcttcg ttcatggaaa gtatcgctgc cgtcttctca accatcgtaa       900
//

If you have problems or comments...

PBIL Back to PBIL home page