(data stored in SCRATCH zone)

EMBL: CP002293.PE266

CP002293.PE266       Location/Qualifiers
FT   CDS_pept        complement(301678..304053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0274"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="KEGG: afl:Aflv_2639 preprotein translocase subunit
FT                   SecA; TIGRFAM: preprotein translocase, SecA subunit; PFAM:
FT                   SecA DEAD domain protein; SecA Wing and Scaffold; SecA
FT                   preprotein cross-linking region"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73122"
FT                   /db_xref="GOA:A0A0F6BI71"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030908"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI71"
FT                   /inference="protein motif:TFAM:TIGR00963"
FT                   /protein_id="ADP73122.1"
FT                   /translation="MLSYVKKLLNSDERRLKRYYKIVDHINALEPKFAKLSDQELREKT
FT                   AYFKNELANGKTVFDIQAEAFAVVREAAKRVLGMRHFDVQLIGGLVLAEGNIAEMATGE
FT                   GKTLVASLPSYLRALEGKGVHVITVNEYLARRDRELIGQIHEFLGLTVGLNLPMMETEE
FT                   KKAAYQADITYGIGSEFGFDYLRDNMVYDISQRVQRPFHYAIIDEIDSILIDEAKTPLI
FT                   IAGKTGVSSELSYLCARIVKTLERDVDYYYDEETKATNLTEEGIAKIERGFGIDNLYDV
FT                   EHQTLYHYIIQALRAHVLFQRDVDYIVRDGKIVLIDMFTGRPMEGRSLSHGLHQAIEAK
FT                   EGLELTEENKTQAAITIQNYFRLYPILSGMTGTAKTEEKEFQTLYGMDVVQIPTNKPVI
FT                   RVDEPDRVFLTIDQKYKAVAKEVKRVHETGQPVLIGTTSILQSEKVAKYLEAENLPFRL
FT                   LNAKTIEQEAQLIALAGQKGQITIATNMAGRGTDIMLGEGVAELGGLFVLGTERHEARR
FT                   IDNQLKGRAGRQGDPGRSQFFISLEDDMFRRFAKEETEKWMKKAKTDENGEILNKEIHE
FT                   FVDRVQRICEGNSFSIREYNLKLDDVLNDQRTAVYRLRNRILEGDRLIPLVIDMLHSYV
FT                   PYEIEQHCPADMLPEEWDLEKLTEQLREIIPFPAVQLSGNINDIEDVKSNVQHSLEQYI
FT                   HYLETMNDAEQVKAEIRPSLLSIVDYYWLNHLDAMERLKEGIGLRFYSQEDPIRQYQRE
FT                   GFELFVYMYHQIEADICRRLAQAVAPKAAASESAGKTS"
     atgttgtctt atgttaaaaa gctactcaac agcgatgaga gacggttgaa gcgctactac        60
     aaaatcgttg atcatattaa tgcactggaa ccaaagtttg caaaactatc cgatcaagag       120
     ctgcgggaaa aaacagctta ttttaaaaat gaacttgcca atggaaaaac ggtatttgac       180
     attcaagcag aagcgtttgc ggtggtgcgc gaagcagcga aacgggtgct cggcatgcgc       240
     catttcgacg tccagctgat cggcgggctt gtgcttgcgg aaggaaacat tgccgaaatg       300
     gcgacaggag aaggaaaaac gctcgtcgcg tcattgccga gctatttgcg cgctttagaa       360
     ggaaaaggag tgcatgtcat taccgtcaac gaatatttag ccagacggga tcgcgaattg       420
     attgggcaaa ttcatgaatt tttagggctg accgtcgggc tgaaccttcc gatgatggaa       480
     acggaagaga aaaaagcggc atatcaagca gatattacat atggaatcgg cagtgaattc       540
     ggctttgatt atttgcgcga caacatggtt tatgacatat cccagcgcgt acagcggccg       600
     tttcactacg cgattattga cgaaatcgac agcatcctca tcgacgaagc aaaaaccccg       660
     ctcattatcg ccggcaaaac gggagtcagc tctgagctaa gctatttatg cgcccgcatt       720
     gtgaaaacat tagaacgcga tgtcgactac tattatgacg aagaaacaaa ggcaacgaac       780
     ttgacggaag aaggaatcgc caaaatcgag cgcggttttg gcatcgacaa cttgtatgat       840
     gtagagcatc aaactttata tcattatatc attcaagcat tgcgcgccca tgtgctgttt       900
     cagcgcgacg tcgattatat cgtcagagac ggaaaaattg tattaatcga catgttcacc       960
     gggcggccga tggaagggcg gagcttaagc cacggcctcc atcaggcgat tgaagcgaaa      1020
     gaagggcttg aattaacgga agaaaataaa acacaggcag cgattacgat tcaaaactac      1080
     ttccggcttt atccgatttt atcgggcatg acagggaccg ccaaaacgga agaaaaagaa      1140
     tttcaaactc tctacggcat ggatgtcgtg caaatcccaa caaacaagcc ggtcatccgc      1200
     gtcgatgagc cggaccgtgt cttcttaaca atcgatcaga aatataaagc ggtcgcgaaa      1260
     gaagtaaaac gtgtgcatga gacaggacag ccggtcttaa ttggaacaac gtccattttg      1320
     cagtcggaaa aagtcgccaa atacttagaa gcggaaaatc tgccgtttcg cctcttaaac      1380
     gcgaaaacga tcgaacaaga agcccagctg atcgcgctgg ccggacaaaa ggggcaaata      1440
     acgatcgcga caaacatggc cggccgcggg acagacatca tgcttggcga aggggtggcc      1500
     gaacttggcg ggctgtttgt gctcggtacg gaacgccacg aagcgcggcg cattgacaat      1560
     cagctgaaag ggcgggccgg ccgccaaggt gatccggggc gttcccagtt ttttatttct      1620
     ttggaagatg acatgttccg ccggtttgcc aaagaagaga cggaaaaatg gatgaaaaaa      1680
     gcaaagacgg acgaaaacgg agaaatttta aataaagaaa tccatgagtt tgtcgatcgc      1740
     gttcagcgca tttgcgaagg caacagcttc tcgattcgcg agtacaactt aaagctcgac      1800
     gacgtgctga acgaccagcg gacagcggtt taccgattgc gcaaccgcat tctcgaaggc      1860
     gatcgcttga ttccgttggt gatcgatatg cttcattcat atgttccata tgaaatcgaa      1920
     caacattgcc cggcggatat gcttccagaa gaatgggatt tagagaagct tactgagcag      1980
     ctgcgcgaaa tcatcccttt tcctgccgtc caactttcgg gaaacattaa cgacatagaa      2040
     gacgtgaaaa gcaatgtcca gcactcgctg gaacaataca ttcattattt ggaaacaatg      2100
     aacgatgccg agcaagtgaa agcggaaatc aggccttctt tgctttccat tgtcgattat      2160
     tattggctga atcaccttga cgcgatggaa cgtttaaaag aaggaatcgg tttgcgcttc      2220
     tacagccaag aagatccgat tcgccaatac cagcgcgaag gattcgagct gttcgtatat      2280
     atgtaccatc aaatcgaagc ggatatttgc cgccgtctcg cacaggcggt cgctccaaaa      2340
     gccgccgcca gtgaaagtgc tggaaaaacg tcctaa                                2376
//

If you have problems or comments...

PBIL Back to PBIL home page