(data stored in ACNUC7421 zone)

EMBL: CP002293.PE267

CP002293.PE267       Location/Qualifiers
FT   CDS_pept        304441..307920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0275"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; peptidase domain protein; KEGG: afl:Aflv_2637
FT                   secreted subtilisin-like serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73123"
FT                   /db_xref="GOA:A0A0F6BI72"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI72"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ADP73123.1"
FT                   /translation="MKKWKKTAVSLGLASALVLPSFAQASTMPPLEQWKKQHAQQHAAK
FT                   ARLAYQRLKEAKDQISEDTLIVKYKEKIPASVHRSLGATLKKSFPQLGYDVVTVQKGKT
FT                   AKEVIRAYAKLKAVKSVTPSFTYKKVSTNDPKNDKMYPLSLLQIDKALQLAGKHSVTVA
FT                   VIDSGVDTKHPDLKAQLLPAYNAVNPAGPVVKDIHGTHVAGIIGATANNGVGAHGINPN
FT                   VKILPIDVFNGEWGASDYVIAQGILYAIEKGAKVINMSLVGYFNSPILEDAVKKAIDAG
FT                   VTVVASAGNEATDEYAVPASYEGVISVGATDSKNHLANFSNYGPSVDIVAPGVDVYSTV
FT                   YDPTKGASFAELSGTSMASPVVAGVASLILSKYPDLKPYEVEAILEKTATDLGEKGYDL
FT                   KYANGLVNPVAALNFDIKKLPKKETWSDETILAKAAPLQLTEETTTKTGSLTAPEQIDW
FT                   LKVDVNAGESIQAVLEGAEDYDYKLILRFYPEGKKQSEKPINVNDTRAGEIEGKLFTAK
FT                   ENGTLVIGVTDANGNYSTQGKSEYTLTLQKLTTLAEDNSTKDNPVAIEQLPFDSDKSEF
FT                   APFTFIPEKEGEVDHDYFTFKVEEPTTVKLNLSPVPGINSTISVYLAEDFYHPADPENG
FT                   PYPIVPPVNNNGSGKGETVTFEADPEMEYVIEVASEPPLDFWYYGLSPQSSGANGDTPA
FT                   SAIPYRLTVEPVTMPPDEDGYPLTDDEEEPAPSEETTPAEEAQLNKKAKEKKDIIIIIE
FT                   DNVPLSFEKEDIQHIKENALPYSLGDKQSAHIQFGEDRDFYKLSSVDDTAVYRFTFDVP
FT                   DDMQPEAVVYEYDPKQDDLYPISEFNGYDYFTGQKTNTFTLFLEKGKQYYLSVANGRYQ
FT                   PSADPYTFTSEKLMDAPKDVNENNNEPIRATVVQPNKAVTGNFALNNDEDIYYYKHRAN
FT                   DDIFTFFARPDKLANKASLPAELQGTLIPIVTVVEDTNGNMSIDDEEVGKMVEFWPTGL
FT                   NPLYDVNGSFKAKKNTGYFFIINSYLYDGLTLQSYRFGIETLPKKDEDAGSVVKNNVPS
FT                   KPLSLKQSGNTFKATGYLNASVDYGDKDYYVFTAAKDGKFTVQLAGGVTMDGVISIYNE
FT                   KGGLVQTFDYYGEGDSEIATVTLKKGKYYIVVEDSFARPSAQPYTLSVSPVK"
     atgaaaaaat ggaaaaaaac agccgtttcg cttgggcttg cgtccgcgct tgtcttgcct        60
     agctttgccc aggcgtccac aatgccgccg ttggagcaat ggaagaagca acatgcccag       120
     caacatgccg caaaggcacg gctcgcttat cagcggctga aagaggcgaa agaccaaatc       180
     agcgaagata cgctgatcgt caagtacaaa gagaaaattc ctgccagcgt ccatcgcagc       240
     cttggcgcaa cattgaaaaa atcgtttccg cagttaggtt atgatgtcgt cacagtgcaa       300
     aaaggaaaaa cggcgaaaga agtgatacgc gcctatgcta agctgaaagc tgtgaagagt       360
     gtcacgccta gttttacata taaaaaggtt agcacgaacg atccgaaaaa cgataaaatg       420
     tacccgcttt cgttattgca gatcgacaaa gcactgcagc ttgccggcaa acatagcgta       480
     acggtggcgg tcattgacag cggtgtggat acgaagcatc ccgatttaaa ggcccagctg       540
     cttccggcat ataacgcagt caatccggca ggcccggtag tgaaagatat tcacggaaca       600
     catgttgccg ggattatcgg ggcgaccgcc aacaacggtg ttggcgcaca tggcattaat       660
     cctaatgtaa aaattttgcc gattgacgtg tttaacggtg aatggggcgc gagcgactat       720
     gtgattgccc aaggtatttt atacgcgatt gaaaaaggag ccaaagtcat caacatgagc       780
     cttgtcggct actttaactc cccgattttg gaagatgcgg taaaaaaagc gattgacgcc       840
     ggcgttaccg tcgttgcgtc agcgggcaac gaagcaaccg atgagtatgc cgtcccggca       900
     tcgtatgaag gcgtcattag cgtcggagcg accgacagca aaaaccattt agcaaacttt       960
     tctaactacg gcccatccgt ggatattgtc gcaccgggcg tcgatgttta cagcaccgtt      1020
     tatgatccga caaaaggcgc atcctttgcg gaattaagcg gaacatcgat ggcttccccg      1080
     gttgtggcgg gcgtggcgtc actcatttta tccaaatatc cggacttaaa gccgtatgaa      1140
     gtggaggcaa ttttagaaaa aacggcgacc gatcttggag aaaaaggtta tgatcttaaa      1200
     tacgcgaacg gccttgtcaa tccggttgcc gcgctgaact ttgacataaa gaaattgccg      1260
     aaaaaagaaa cgtggagcga tgaaacgatt ctcgccaaag ctgctccgct gcagctgacg      1320
     gaagaaacaa caacaaaaac gggaagctta acagcaccgg aacaaatcga ctggctgaag      1380
     gtggatgtta acgccgggga aagcatccaa gccgtgctgg aaggtgcaga agattacgat      1440
     tacaagctga tcttgcgctt ctaccctgaa ggcaaaaaac aatccgaaaa gccaatcaat      1500
     gtcaatgaca cgcgcgctgg agaaatagaa ggaaaattgt ttacagcaaa agaaaacggc      1560
     acgcttgtca tcggcgtcac ggatgcgaat ggcaactata gcacgcaagg aaaatcggag      1620
     tacacgctaa cactgcaaaa attaacaacg ctggcggagg acaattccac gaaagacaat      1680
     cctgttgcca ttgaacagct tccttttgac agcgacaagt cagaattcgc gccatttact      1740
     ttcatcccgg aaaaagaagg ggaagtggat cacgattact tcacatttaa agtggaagaa      1800
     ccgacaacag tgaagctgaa tctttcgccg gttccgggca ttaattcgac aatcagcgtt      1860
     tacttagcgg aagacttcta tcatccggct gatcccgaga atggcccata tccgattgtt      1920
     ccaccagtaa ataataacgg cagcggaaaa ggcgagacag tcacgtttga agcagatccg      1980
     gaaatggaat atgtcattga agtggcaagc gaaccgccgc tcgatttttg gtactatggc      2040
     ttgtccccgc aatcctccgg cgcaaatggt gatacgccag cgtccgccat tccgtaccgt      2100
     ttaacggtgg agccggtaac catgccgccg gatgaagatg gatatccgct gacagatgat      2160
     gaggaagaac cggcgccatc ggaagagacg actccggctg aagaagcgca gctaaacaaa      2220
     aaagcgaaag aaaagaaaga tattattata ataatagaag ataacgtccc gttgtctttc      2280
     gaaaaagaag acatacagca cataaaagaa aatgcgcttc cttacagcct tggcgataag      2340
     cagtcggcgc atatccaatt tggcgaagac cgcgattttt acaagctgtc ttctgtcgat      2400
     gacacagcgg tttaccgctt tacatttgat gtgccggatg acatgcagcc agaggcggta      2460
     gtgtatgaat atgacccgaa acaagacgac ttatatccta tcagcgaatt taacggctat      2520
     gactacttta caggacaaaa gacaaacacg ttcacgctat ttttagaaaa aggaaaacaa      2580
     tattatttat cggttgccaa tggccgttac caaccgtctg ctgatccata tacatttaca      2640
     tcggaaaaat taatggatgc gccgaaagac gtgaatgaaa acaataatga gccaatccgc      2700
     gcgacggtcg ttcagccgaa caaggctgtg acaggcaatt tcgcgttaaa caatgatgag      2760
     gatatatact attacaaaca ccgtgccaat gacgacatat tcacattctt tgcgcgcccg      2820
     gataaattgg caaacaaagc aagcttgccg gctgaattgc aaggcacgct aattccgatt      2880
     gtgacagtgg tggaagatac gaatggaaac atgtctattg atgacgaaga agtggggaaa      2940
     atggttgaat tttggccgac cggactcaat ccgctgtacg atgtgaacgg ttcgtttaaa      3000
     gcgaagaaaa acacaggcta tttctttatc ataaacagct atctgtacga tggactaacg      3060
     cttcaatcat accgattcgg cattgaaacg ctgccgaaaa aagatgaaga tgcgggatct      3120
     gtggtgaaaa acaacgtgcc atctaaaccg ctcagtttga aacagtcggg aaatacgttc      3180
     aaagcgacag gctatttgaa cgcgtccgtc gattacggcg ataaagacta ttatgtgttt      3240
     accgcggcga aagacggcaa atttaccgtc cagcttgctg gcggcgttac gatggatggc      3300
     gtcatctcca tttataatga aaaaggcggg cttgtgcaaa cattcgacta ttatggcgaa      3360
     ggcgacagcg aaattgctac tgttactttg aaaaaaggaa aatactacat tgtcgtggaa      3420
     gacagttttg cccgcccgag cgcgcagcca tatacgcttt cggtttcacc agtaaaataa      3480
//

If you have problems or comments...

PBIL Back to PBIL home page