(data stored in SCRATCH zone)

EMBL: CP002293.PE27

CP002293.PE27        Location/Qualifiers
FT   CDS_pept        40637..41629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0027"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /note="TIGRFAM: DNA polymerase III, delta prime subunit;
FT                   KEGG: gwc:GWCH70_0027 DNA polymerase III, delta prime
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72883"
FT                   /db_xref="GOA:A0A0F6BHI2"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHI2"
FT                   /inference="protein motif:TFAM:TIGR00678"
FT                   /protein_id="ADP72883.1"
FT                   /translation="MAMEWEQLERYQPAVVKMLTKSLEKGRISHAYLFEGQRGTGKKAM
FT                   SLLLAKSLFCLNRSGIKPCNECRNCRRIDSGNHPDVHIIEPDGQSVKKEQIEMLQQEFT
FT                   KTAVESDRKLYIIEHADKMTTNAANSLLKFLEEPRPGTVAILLTEQYHRMLETIISRCQ
FT                   VFSFKPIPPALLANYLEKQQIPPHIAFLAAHVTNNYEEALQLSRDDWFAQARKIVLQLY
FT                   ETLKKNDLQALFFVHDQWLPHFQEKPQIDLGLDLLLYIYKDMLHIQLGQVEQIIYRDRL
FT                   DDLRQWSLSCPQRQIVKSMEMILRAKARLNTTNMSVQLLMEQLILDLKE"
     gtggctatgg aatgggagca gctcgaacga tatcaacctg cagtagtgaa aatgctcaca        60
     aaaagcctgg aaaaagggcg aatttctcat gcctatttgt ttgaggggca gcgcggaacg       120
     ggaaaaaaag caatgagtct tttattggca aaaagcttat tttgtttaaa tcgttccgga       180
     atcaagccat gcaatgaatg tcggaattgc cgcagaatcg attccggaaa ccatccggat       240
     gtccatatta ttgaaccgga tgggcaatcg gtgaaaaaag agcaaattga aatgctacag       300
     caagagttta cgaaaacggc ggtagagtcg gaccggaagc tgtatattat tgagcatgct       360
     gacaaaatga caacgaacgc agcgaatagc ttgttaaaat ttttagaaga acctcgtcca       420
     gggacggtag caatattgct tacagaacaa tatcaccgca tgctggaaac gatcatttcc       480
     cgttgccaag tgttttcgtt taagccaatc ccaccagctt tgcttgctaa ttatttggaa       540
     aaacagcaaa ttccgcctca tattgctttc cttgctgcac atgtgacaaa caattatgag       600
     gaagcgctcc aattaagccg agatgattgg tttgcgcagg cgagaaaaat agtgttacaa       660
     ttatatgaaa cgttaaagaa aaatgatttg caggcacttt tttttgttca tgatcaatgg       720
     ctgcctcatt ttcaagaaaa accacaaatt gatttaggat tggatttgct tttatatata       780
     tataaagata tgctgcatat tcaattagga caagtggaac aaatcattta tcgcgatcgt       840
     cttgatgatt tgcggcaatg gtcgctttcc tgtcctcaac ggcagattgt aaaaagtatg       900
     gaaatgattt tgcgggcaaa agcgcgttta aatacaacga atatgagcgt acagctttta       960
     atggagcagc ttatccttga cctaaaggag taa                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page