(data stored in SCRATCH zone)

EMBL: CP002293.PE271

CP002293.PE271       Location/Qualifiers
FT   CDS_pept        314767..316284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0279"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: bha:BH3998
FT                   transposase (25)"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73127"
FT                   /db_xref="GOA:A0A0F6BI76"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI76"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADP73127.1"
FT                   /translation="MLAVAEIHYIRYEANQKGCSYSDIAKRMNRDPRTVKKYAEMEDFN
FT                   PSKVKQTRKAKVMDPVKPILDQWIKEDLTKKKKYRRTAKRMYEILKEEYGFTGSDRSVR
FT                   LYVSKRKQELLEQSESAALPLESKPAMAQVDFGEAPFLYQGKYVDFPYLVVSFPYSNAA
FT                   YVQVMPAQNQECFLEGLKRIFHYMGRVPRVIRFDNLSPAVKTILPNGERELTETFQRFV
FT                   LHYGFECEFCNPASGNEKGNVESKVKYIRNNFFLPEQTIYQLESFNESLWEKCEKDWNR
FT                   PHYEKERLIAELFEEEQALFLQLPAKEFECVRYEQVTADKYGFIHLENNLYSTSPRFAK
FT                   QKVLAKISYHEIAILTEEHELIIKHERLYGTKQKSMKWQPYLTLMAKRPNALKYTDFYE
FT                   KMPEEWKNYFSNCTVQEKKEALQLLAVLLKEHDFEVSTQALRIASQYGHPKVESIKQVF
FT                   YQLINGRGIREPIQPKKHVPDMPEAIRGVRHYDRLFESQGDVASWNK"
     atgttagcag tggctgaaat tcattatatc agatatgaag caaaccaaaa aggatgttcc        60
     tattccgata ttgccaaaag aatgaatcgt gatccaagaa cagtgaagaa gtatgcggaa       120
     atggaagact tcaatccctc aaaagttaaa caaacgagaa aagcgaaagt gatggatcca       180
     gtgaaaccga tattggatca atggattaaa gaggacttga caaagaagaa aaaatatcga       240
     agaactgcga aacgaatgta tgaaatctta aaagaagaat atggatttac aggttcagat       300
     cgttctgttc ggctctatgt atcaaaaaga aaacaagaac tgctcgaaca aagtgaatca       360
     gctgcgttac ctttagaatc gaaacctgca atggctcaag ttgattttgg agaagctcct       420
     tttctctatc aggggaaata cgtcgatttt ccttacctgg tcgtttcatt cccttacagt       480
     aatgcggcct atgtgcaagt catgccagct caaaatcaag aatgtttctt ggaaggatta       540
     aaacgaatct ttcactatat gggaagggtt ccaagggtca ttcgttttga taatctctcc       600
     cctgcagtaa aaacgatctt gccaaacgga gaaagagaat tgacagagac atttcaacga       660
     ttcgttttac attatggctt tgaatgcgag ttctgcaacc cagccagcgg aaatgaaaaa       720
     gggaatgtcg aatcaaaggt gaaatatatt cgaaacaatt tctttttacc tgaacaaaca       780
     atctatcaac tagaaagttt taatgaatct ttatgggaga aatgtgagaa ggactggaat       840
     cgtccgcatt atgagaagga gcgactcatc gctgaattat ttgaagaaga acaagcgtta       900
     tttcttcaat tgccagccaa agaatttgaa tgtgtccgat atgagcaggt cacggctgat       960
     aagtacggtt tcatccattt agaaaacaat ttatattcca cgtctccccg ttttgccaaa      1020
     caaaaggttt tggcaaagat ctcttatcat gagattgcca ttttaacaga agagcatgag      1080
     ctgattatca agcacgagcg tttatatggc acaaaacaaa aatcaatgaa atggcaacca      1140
     tatcttacgt taatggccaa aaggccaaat gcattaaaat atacggattt ctatgaaaag      1200
     atgccggaag aatggaaaaa ttatttttcc aattgtaccg ttcaagaaaa gaaggaagca      1260
     ttacaactac tagctgtttt actaaaagaa catgatttcg aagtttcgac acaggctttg      1320
     aggattgcct cccagtatgg tcatccgaaa gtagaatcga ttaaacaggt attttatcaa      1380
     ttaatcaatg gaagaggtat acgagagcca attcaaccga aaaaacacgt tccagatatg      1440
     ccggaagcca tccgaggagt aaggcattat gaccgcctat tcgaatccca aggagatgtg      1500
     gcatcatgga acaaatga                                                    1518
//

If you have problems or comments...

PBIL Back to PBIL home page