(data stored in ACNUC7421 zone)

EMBL: CP002293.PE272

CP002293.PE272       Location/Qualifiers
FT   CDS_pept        316272..316991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0280"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="manually curated; PFAM: IstB domain protein
FT                   ATP-binding protein; KEGG: bha:BH3999 transposase (26);
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73128"
FT                   /db_xref="GOA:A0A0F6BI77"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI77"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ADP73128.1"
FT                   /translation="MEQMIKEYAKRLKLSWIPANYHTIHAETNEEFLLKLFEREVQHRD
FT                   ERRINLLLKQATLPKIPNKPYDWREIQLAPGITKDYILEGEFTKNQENLIFYGGVGTGK
FT                   TFLSTLIALNLMKKQGKRVKFYTAASIVNALLEANEKGDLGKFLNQIEKLDLLILDELG
FT                   YIPLHKQGAELLFQVISMCYETKSIIVTTNLPFSQWNNVFGDPILTEAVIDRLIHHSHL
FT                   IIFNGESHRYKDSISQR"
     atggaacaaa tgattaagga atatgccaaa agactaaaat taagctggat tccagccaat        60
     taccatacca tccatgcgga aacaaatgag gaatttttac tgaagctgtt tgaacgagaa       120
     gtgcagcatc gagatgagag aaggataaat ttactactaa aacaggcgac attgccgaaa       180
     attccaaata aaccttatga ttggcgggag attcaactag ccccaggcat cacaaaagat       240
     tatattttag aaggtgagtt tacgaaaaat caggaaaacc ttatcttcta tggcggagtg       300
     ggaaccggta aaacattcct ttccactctc atcgccctca atttgatgaa aaaacaagga       360
     aaaagagtga agttctatac ggccgcctcc attgtcaatg ctttattgga ggccaatgaa       420
     aaaggtgacc ttggtaaatt tctcaatcaa atcgaaaagt tggatctctt gattcttgat       480
     gaattgggct atattccatt gcataaacag ggggcagagt tattatttca agttatttcc       540
     atgtgttatg aaaccaaaag catcattgtg acaaccaatt taccttttag ccaatggaat       600
     aatgtctttg gcgatcccat tttaacagag gccgtcattg atcggctgat tcatcattct       660
     catttaatca tcttcaatgg tgaaagtcac cgatacaaag actcaatctc tcaacgttaa       720
//

If you have problems or comments...

PBIL Back to PBIL home page