(data stored in ACNUC7421 zone)

EMBL: CP002293.PE277

CP002293.PE277       Location/Qualifiers
FT   CDS_pept        320700..321482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0285"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG:
FT                   gwc:GWCH70_3446 transposase mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73133"
FT                   /db_xref="GOA:A0A0F6BI82"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI82"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ADP73133.1"
FT                   /translation="MTDVVKEDIEKWHNRPLLKRYSVLYLDGLYVKLRRDTVEKEVIYV
FT                   VLGVNEEGYREILDFFVGGQESAYGWQEILQHLYQRGVKEMLLGVFDGLPGLDEAFRAF
FT                   YPKADVQLCIVYKVRNTLHRVRKKDQFEAAEDLKLIYLAPNKEWALQMFQQFQSKWSGK
FT                   YPKEVQSWANELDVLLTFTKYPSSMRSVIYTTNAIERTIKEIRKRLKPMNSLSSLEAAE
FT                   KVVYLTIQDFIEKWAERKLRGFTEAQKALQRMFEERYN"
     atgaccgatg ttgtgaagga agacatcgag aaatggcata atcgccctct gctcaagcgt        60
     tattcggtct tatatttgga cggcttgtac gtgaaacttc gccgcgatac cgtggagaaa       120
     gaagtcattt atgtggtgtt aggagtgaat gaagaaggat atcgcgaaat tcttgatttc       180
     tttgtgggag gacaggaaag cgcctatgga tggcaggaaa ttctgcaaca tctttaccaa       240
     agaggagtca aggaaatgct tctgggcgta tttgatggac taccggggct ggatgaagcc       300
     tttcgggcgt tttatccgaa agctgatgtg caactctgta tagtttacaa agtacgtaat       360
     accttacatc gtgttcggaa aaaagatcaa ttcgaagcag cagaagatct caagctgatt       420
     tatctcgcac caaataagga atgggcgtta caaatgtttc aacagtttca gtcgaaatgg       480
     tccggcaaat atccaaaaga agttcagtct tgggccaatg agttagatgt cctcctcacc       540
     tttacgaaat atccaagcag tatgcgaagt gtgatttaca cgaccaatgc catcgaacga       600
     acgatcaagg agattcggaa acgtctaaag ccgatgaaca gtttgagcag tttagaagcc       660
     gctgaaaaag tcgtatattt gacgatccaa gactttattg agaaatgggc ggagcgaaag       720
     ttgcgaggat ttaccgaagc gcagaaagcc ctccaacgaa tgtttgaaga acgttacaat       780
     taa                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page