(data stored in ACNUC7421 zone)

EMBL: CP002293.PE279

CP002293.PE279       Location/Qualifiers
FT   CDS_pept        322097..322891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0287"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: protein of unknown function DUF955; KEGG:
FT                   gwc:GWCH70_3067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73135"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI84"
FT                   /inference="protein motif:PFAM:PF06114"
FT                   /protein_id="ADP73135.1"
FT                   /translation="MITKDNLEMILEHNKTYLPKMKKAMDRIYSLGDPLAHVKPLDFIK
FT                   TYLYEHANVLQFPIQNADYGGLVYYYNGDYYVHINTAQPRIYENFMWAHEFYHFFFDRE
FT                   KIKNPDQNFIMIDYIYDEKERLPNLFASEFLINDFVLERSFKFLETAHTKQSLPEKIMR
FT                   LINVFQLPYKALVVKLAQNELITINEAKSALDYDYRNRIPHDIDKSFFEPSYTINISGF
FT                   DELYEKAKGLMYEEDLQSIKKSFDKLYEQVLVSVHDQRRTKG"
     ttgattacaa aagataatct tgaaatgatt ctagagcata acaaaacata tttgccgaaa        60
     atgaaaaagg caatggaccg tatttactcc ctcggagatc ctcttgcaca tgtaaagcct       120
     cttgatttta taaaaaccta tctttacgag catgcaaatg tattgcagtt tccgattcaa       180
     aatgctgact atggtgggct tgtgtattac tataacggtg attattatgt ccatattaat       240
     accgcacagc cgagaatata tgaaaatttc atgtgggcgc acgagtttta tcatttcttt       300
     tttgacagag agaaaattaa aaaccctgat caaaatttta tcatgattga ttatatttat       360
     gatgaaaagg agcggcttcc taatctcttc gcttccgaat ttttaattaa tgactttgtg       420
     ttagaaagaa gtttcaaatt tttagaaact gctcatacga aacaatcgct cccagaaaaa       480
     attatgcgat taatcaatgt tttccagctc ccatataaag cgttagttgt gaaacttgct       540
     caaaacgaat tgatcacgat taatgaagcg aaaagtgcat tggactatga ttatagaaat       600
     cgtattcctc atgatataga caaatcattt ttcgagccta gttatacgat aaatatcagc       660
     gggtttgatg aattgtatga aaaagcgaaa ggattgatgt atgaagagga tcttcaatcg       720
     attaaaaaat cttttgataa gttatatgaa caagtgttgg tgtcagtaca tgatcaaagg       780
     aggactaaag gatga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page