(data stored in SCRATCH zone)

EMBL: CP002293.PE280

CP002293.PE280       Location/Qualifiers
FT   CDS_pept        322888..323730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0288"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3066 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73136"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI85"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3066"
FT                   /protein_id="ADP73136.1"
FT                   /translation="MKVLDSPVLESVRPFISDNTEQLYQSLNEHQAFYMFDNMILTKLR
FT                   KQISNLPLLLQAFHQSPVFLIPDVVLEESFRNIPTKERYNDYYFELFKQLSAKKQLYII
FT                   SMETIYQLLEKGMTKKQYIFDVMKQLALEAFRVNRDIINNLERCELSSFSDLPKLRQII
FT                   LHNGNNAGERFICFFALLLVHQYYGPAYICSDDGKGVYTMYNTFVNNESLFRILGVDDF
FT                   LMLKEQYILLSYDCILQLSIKNTGLSSKEIYAFVQSSGRNDVYCKIKIQSSARKTCRA"
     atgaaggtcc tcgattctcc tgttttagaa tcggttcgtc cgtttatttc agataatacg        60
     gagcaattgt accagtcgct aaacgaacat caagcatttt atatgttcga taatatgatt       120
     ttaacgaaat taagaaaaca aatatccaat ttgccgcttt tgcttcaagc gtttcatcag       180
     tcgccggttt ttcttattcc tgatgtagtg ttagaagagt cttttaggaa tattcccaca       240
     aaggaacggt ataacgatta ttactttgag cttttcaaac aattatcagc aaagaagcag       300
     ctatacatta tatcgatgga aactatttat caattattag aaaaaggaat gacgaaaaag       360
     caatacatat ttgatgtgat gaaacaacta gctttggagg ctttcagagt aaatagagat       420
     attattaata atctggaacg atgtgaatta tcttcttttt cggatcttcc gaaattgaga       480
     caaatcattt tacataacgg aaataatgca ggagagcgct ttatttgttt tttcgcatta       540
     ttgcttgttc atcagtacta cggtcctgcc tatatatgta gtgatgacgg caaaggtgta       600
     tatacgatgt ataatacttt tgtaaataac gaaagtttat ttcgaatatt aggtgtcgat       660
     gattttttga tgttgaaaga gcaatacatc ctgctatctt atgactgtat tctacaatta       720
     tccattaaaa acacggggtt aagttcaaaa gaaatctatg cttttgtgca gagtagcggt       780
     cgaaacgatg tttattgcaa aataaaaata cagagttctg caaggaaaac gtgcagagct       840
     tga                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page