(data stored in SCRATCH zone)

EMBL: CP002293.PE281

CP002293.PE281       Location/Qualifiers
FT   CDS_pept        323816..325345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0289"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   gyc:GYMC61_2738 integrase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73137"
FT                   /db_xref="GOA:A0A0F6BM83"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BM83"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADP73137.1"
FT                   /translation="MLAMPEIHYIKHLRENKDLSISEIARKTGLNWRTVKKYADGNIGG
FT                   QKIMKKKRGMMYELGYGEIIDDWLEEDAKLPRKERRTNRTMFEQLQKEHGFPGSYRTVC
FT                   AYIQERKPHLKAEKEKRYERLEHPPGEAQVDFGTMQVVKDGALEDKKLLILSFPHSNAG
FT                   FAHPLPSENRECFLEGLKQLFHQAGGVPRRLRMDNLPAAVVTVGKGDNRQYTEAFLRFQ
FT                   AHYGFEVQPCNPASGHEKGNVERKVYYVRHRCFVPAPVVESDEQLTEWLRVKMIEDRSR
FT                   LHYEKGVPIEELWKEDQKELKALPLDDLPIFSLDTVKVNKYGEITVDGEKWVIHQARVN
FT                   QSLVVQKGWDRFICLSNQGEVVFEAPRPYMNQKQEIPWEEIFNDWEKKPRSVSYSRFFK
FT                   YLPEKVQTYLTFRKEEVKQRVRGVRELLKSHTLKELDEWLNKEQRFDLAPHELKVLLEA
FT                   KQQAYPEKWEETYTPSVFVNYETDLHLYDQRLCPSWEGGANRDDSGHQRDL"
     atgctagcaa tgcctgaaat tcattatatc aaacatttaa gggaaaacaa agatctgtcg        60
     atctcggaaa ttgcgagaaa gacagggctg aattggagaa ctgtcaagaa atatgccgat       120
     ggaaatattg gcggacaaaa aatcatgaaa aagaaacggg ggatgatgta cgagctagga       180
     tatggggaga tcatcgatga ctggctggag gaggacgcga agctgccacg aaaagagcga       240
     agaaccaatc gaaccatgtt tgaacaactg caaaaagagc atggttttcc cggttcttac       300
     cgaactgtat gtgcctacat tcaggaacgg aagccgcatc tcaaggcaga aaaggaaaaa       360
     cgatacgaac ggctggagca tcctccgggg gaagcccaag tcgattttgg cacgatgcaa       420
     gtagtgaagg atggagctct tgaagataaa aagctcttga ttttgagctt cccccatagt       480
     aatgctggat ttgctcatcc tctcccgtca gaaaataggg aatgcttctt ggaaggattg       540
     aaacagttat ttcatcaagc agggggagtg ccgaggcgtt taaggatgga caatttgccc       600
     gctgccgtgg tgacagtcgg gaaaggagat aaccgtcagt ataccgaagc gtttctgcgt       660
     ttccaagccc actacgggtt tgaagtacag ccgtgcaatc ccgccagtgg gcatgaaaaa       720
     gggaatgtgg agaggaaagt atactacgta cgccatcgtt gtttcgttcc cgcccctgtg       780
     gtggaaagcg atgaacagct gaccgaatgg ctacgggtca aaatgatcga agatcgttct       840
     cgccttcact atgaaaaagg agtgccaatt gaagagttgt ggaaagaaga tcaaaaagag       900
     ctgaaagcat tgcctttgga cgatcttccg atcttctctt tggatacggt gaaagtaaac       960
     aaatacgggg agattacagt ggatggggaa aagtgggtga tccatcaagc tcgggtgaac      1020
     cagtctctcg tggtgcaaaa agggtgggat cgctttatct gcctatccaa tcaaggagaa      1080
     gtcgtttttg aagctcctcg gccgtatatg aaccagaaac aggaaatccc ttgggaagag      1140
     attttcaacg attgggagaa gaagcctcga tccgtgagtt attcgcgatt ttttaagtac      1200
     ttgccagaga aggtgcaaac atatttgacc ttccgtaagg aagaggtcaa acagcgcgtt      1260
     cggggagttc gggaactctt aaaaagccat acattgaaag aactggatga atggttgaac      1320
     aaagagcaac gattcgactt ggcccctcat gagttaaagg tgttgttaga ggcgaaacaa      1380
     caagcttatc cggaaaagtg ggaagaaact tacacccctt cggtgtttgt caattatgag      1440
     acggatttac acctttatga ccaacggctg tgtccgtcat gggaaggagg ggcaaaccgg      1500
     gatgactcgg gacatcaaag agatttgtaa                                       1530
//

If you have problems or comments...

PBIL Back to PBIL home page