(data stored in ACNUC7421 zone)

EMBL: CP002293.PE282

CP002293.PE282       Location/Qualifiers
FT   CDS_pept        325317..326057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0290"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="KEGG: gyc:GYMC61_2739 IstB domain protein
FT                   ATP-binding protein; PFAM: IstB domain protein ATP-binding
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73138"
FT                   /db_xref="GOA:A0A0F6BMA2"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BMA2"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ADP73138.1"
FT                   /translation="MTRDIKEICKALHLAYIADRFEEVPYETKEQFLRDVLALEVSSRQ
FT                   EAKRSKLIKKAKFRELKWLKDYEWSDHIHWPSTTTKEELCDLVFLERRQNVLLLGSPGT
FT                   GKTHLATALGLKACEKGHEVRFFRVADLVAQLEEALKNGTLPRLKRQIETCELLILDEL
FT                   GYVPFQKQGSELLFHIIADCYERKSVIVTSNLEFGQWNRVFGDNRLTAALVDRLVHHAH
FT                   IIAFTGESYRLRHALSSVKKISSN"
     atgactcggg acatcaaaga gatttgtaaa gcgttgcatt tggcgtatat tgccgatcgt        60
     tttgaggagg tgccatacga aacaaaagag caatttttgc gggatgtact ggctttggaa       120
     gtctcatcgc gtcaagaagc gaaacggtcg aagctgatca agaaggctaa attccgggag       180
     ttaaagtggc tgaaagacta tgagtggtcc gatcacattc attggccctc cacaacgacc       240
     aaagaggagc tttgcgacct tgtgtttttg gagcggagac agaacgtatt gcttttggga       300
     tcgcccggaa ccgggaaaac ccatttagcc acggctttag gattgaaggc atgcgagaaa       360
     ggccatgagg tgcggttttt ccgagtggct gatctcgttg cccaactgga agaggcctta       420
     aaaaacggga cactgccccg tctgaaacgg caaatcgaga cgtgcgaact attgattctc       480
     gatgaactgg gatatgtgcc gtttcaaaaa caagggtcag aactgctttt tcacatcatc       540
     gcggactgtt acgaacgaaa aagtgtcatc gtgacctcga atttagagtt tggacagtgg       600
     aaccgggtat ttggggataa ccgtctcacc gctgcgttag tggaccgtct ggtccatcac       660
     gcccatatca ttgcctttac aggagaaagc tatcgtctaa gacacgcgct ttcttctgtg       720
     aagaagatat catccaatta g                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page