(data stored in ACNUC7421 zone)

EMBL: CP002293.PE284

CP002293.PE284       Location/Qualifiers
FT   CDS_pept        complement(327943..328311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0293"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: gwc:GWCH70_3052 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73140"
FT                   /db_xref="GOA:A0A0F6BI89"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI89"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADP73140.1"
FT                   /translation="MNLINFLLILSNTCILVIGQFLWKYGMMKTSFSLDPFSIIKLLFS
FT                   PFIFSGLVMYGAATILWLFILSRVPLSVAYPVQSIAYVLAVFGAYFVFHEPLSPAKIIG
FT                   VILIILGVSLIGISPNTQ"
     atgaatctca ttaatttttt attgatttta tccaatacat gtattctcgt tataggtcag        60
     tttttatgga aatacggcat gatgaaaaca tcgttttcat tagatccctt ttccatcatc       120
     aaattattgt tttctccgtt tattttttcc ggtctcgtga tgtacggcgc agccaccatt       180
     ttatggcttt ttattttatc acgcgtccca ttaagcgttg cctatccggt gcaaagcatc       240
     gcgtatgtgc tcgctgtatt tggcgcctat tttgtttttc atgagccgct ttcgccggcc       300
     aaaatcatcg gggtcattct cattatattg ggggtctctc tcatcggaat atcgcctaat       360
     actcaataa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page