(data stored in SCRATCH zone)

EMBL: CP002293.PE285

CP002293.PE285       Location/Qualifiers
FT   CDS_pept        complement(328298..328666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0294"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3051 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73141"
FT                   /db_xref="GOA:A0A0F6BI90"
FT                   /db_xref="InterPro:IPR019277"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI90"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3051"
FT                   /protein_id="ADP73141.1"
FT                   /translation="MGKVQIITIAFASLFLIQVVYYSSRNKLRDKQAFLWFLMAFIGIF
FT                   IAVCLDWFNKIAALLGVAYMPALIFTIAFLVILNILIYQSVTLSDHQEKIKTLVQEIAY
FT                   LKHELEEYQRKGEKDESH"
     atgggaaaag tccagataat tacgatcgca ttcgcgtctc ttttcctcat tcaagtcgtt        60
     tattattcca gccgcaataa attgagggac aagcaagcat ttctttggtt tttaatggct       120
     tttatcggca tattcattgc ggtctgcctc gattggttca ataaaatcgc tgcacttctc       180
     ggcgtggcct atatgcctgc cctcatcttt acaattgctt ttttggtcat cctgaatatt       240
     cttatttacc agtcagtcac gttatccgat catcaagaaa aaataaaaac gctcgtgcaa       300
     gaaatcgctt atctgaaaca tgaattggaa gaatatcagc gtaagggaga gaaagatgaa       360
     tctcattaa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page