(data stored in SCRATCH zone)

EMBL: CP002293.PE286

CP002293.PE286       Location/Qualifiers
FT   CDS_pept        complement(328685..329368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0295"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   gwc:GWCH70_3050 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73142"
FT                   /db_xref="GOA:A0A0F6BI91"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI91"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADP73142.1"
FT                   /translation="MDILVIIPAYNEEAVIKNTVMNVMKTCPYDYIVINDGSTDRTLDI
FT                   LKENQFHYLDLPVNLGIGGAMQTGYRYALQKGYQYAIQLDADGQHNPKDLENLVSEIKN
FT                   SGCDMVIGSRFVQKTGYKGSLFRRMGILYFYYLLYMIAGIKITDPTSGYRIVNRKVMRE
FT                   FANYYPVDYPEVEVLAKLAKKGYKIKEIKVDMNARQGGKSSITPLKSLYYMTKVTFISV
FT                   IRSIF"
     gtggatattc ttgtcattat ccccgcttat aatgaagaag cggttataaa aaatacagtg        60
     atgaatgtaa tgaaaacatg cccatatgac tacatcgtga ttaatgatgg ctctaccgac       120
     cggacattag atattttaaa agaaaatcaa ttccattatt tagatttgcc agttaattta       180
     ggaatcggcg gcgcgatgca gacagggtat cgctacgccc tccaaaaagg ataccaatat       240
     gcgattcaat tagatgcgga cggccaacat aacccaaaag atcttgaaaa tcttgtttcc       300
     gaaattaaaa attccggttg cgatatggtg atcggttccc gctttgtgca aaaaacgggt       360
     tataaaggaa gccttttccg gagaatgggg attctttatt tttactacct gctatatatg       420
     atcgccggaa tcaaaatcac cgatccaacc tcgggatacc gaatcgtcaa ccgtaaagtg       480
     atgagggaat tcgctaacta ttatcctgtc gattatcctg aagtggaagt gctggcgaaa       540
     ctagcaaaaa aaggatacaa aattaaagag atcaaagtag acatgaatgc gagacaaggc       600
     ggaaaatcgt cgatcactcc tttaaaatca ttatattata tgacaaaagt cacttttatt       660
     tccgtgatcc gctctatttt ttaa                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page