(data stored in SCRATCH zone)

EMBL: CP002293.PE288

CP002293.PE288       Location/Qualifiers
FT   CDS_pept        331567..333498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0297"
FT                   /product="S-layer domain-containing protein"
FT                   /note="PFAM: S-layer domain-containing protein; KEGG:
FT                   lsp:Bsph_1118 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73144"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI93"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ADP73144.1"
FT                   /translation="MFKHFKIWVGVLMAAFICVNVMHSHKAKAEEKVRVGLVVSELSEK
FT                   YAFIKREGGYYNGTYIQPKQIGSSIKNKRIKARLLLENLGYEVEHVNDAQLSDPKQLAK
FT                   FDSLFFPNTVMMSKAQRQAVKEYIKNGGGAIFAFAAARNDSARFPYKETDLDLTPIIYE
FT                   TKTWIWEWDNLSEVFQSAFINDVAIGNYTIRSAGNHPIVANALKRLGKTSILLENRRFG
FT                   KYQPTWIEVIQPYQNNSYVTPILQYETIGYSSVPKHTPPKTGAAYAIEYGKGKAVWFGF
FT                   QLLDYMTVDERLSNEWDEKNPNGQREVKGKAWDFLYGGEDLKILLDECVKWSAQPLAKF
FT                   HPIDRKVTMSLTDVRAYPRASDYVVYGTMKAKNNGNIISRGTMKVELTDPSGKVKASYE
FT                   KYVVGLVPKGESYPEKFVLTLPKNTPVGNYRLTAYYRAGRNNKAGVKVAGNTKIISIKD
FT                   NRKSASILNMPSFKDISSHYWAKEDIDNLISLGVITGYQDGTFKPEAPVSRLQAAAMIV
FT                   RSLGLSTKNRPDPQLEDVKPGQYGYDVIATVVDEGIFSGANGRFHPNAPLTREQMAKIL
FT                   VNAYRLTGEEEVHFRDISSSQWSKPYIATLLANQVTQANGLFRPNERTTRAQFAAFVSR
FT                   SLRAADMD"
     atgtttaaac atttcaaaat atgggttggc gtgttaatgg ccgcttttat ttgcgtgaat        60
     gtgatgcatt cccataaagc gaaagcagaa gagaaagtgc gtgttgggct ggttgtttcg       120
     gaactgagcg aaaagtacgc ctttattaaa agagaaggcg gctattataa tgggacatac       180
     attcagccga aacaaatcgg atcgtctata aaaaataaac ggataaaagc ccggttattg       240
     cttgaaaatt tgggatatga agtggaacat gtgaatgatg cgcagctcag cgatccaaag       300
     caattggcga aatttgattc tcttttcttt ccgaacacgg tgatgatgtc aaaagcgcag       360
     cgtcaggcag taaaagaata tataaagaat ggcggcggag ccatctttgc gtttgcggct       420
     gcaagaaatg atagtgcgcg cttcccatat aaagaaacag atttagattt aacgccaatt       480
     atatatgaaa cgaaaacgtg gatttgggaa tgggataatt tgagtgaagt gtttcagtcc       540
     gcgtttatca atgatgtggc gatcggcaat tacacgataa gaagcgctgg caatcatcct       600
     attgtggcaa atgcgttgaa acggctggga aaaacaagca ttcttctgga aaaccgccgt       660
     ttcggcaaat atcagccaac atggattgaa gtgattcaac cttatcaaaa taatagttat       720
     gtgacaccga ttttgcagta tgaaacgatt ggttattctt ctgtaccgaa gcatacgcct       780
     ccgaagaccg gtgctgccta cgctatcgaa tacggaaaag gaaaagcggt ttggtttgga       840
     tttcaattat tagattatat gacggtggat gaacggctat cgaatgaatg ggatgaaaag       900
     aatccgaatg gacaacggga agtaaaagga aaagcgtggg acttcttata tggaggcgaa       960
     gatttaaaaa tcttgctgga cgaatgtgtg aaatggagcg cacagccact ggcgaaattc      1020
     catccaattg ataggaaagt aacgatgtcg ctgaccgacg tccgggcata tccgcgcgca      1080
     agcgattatg tcgtgtacgg aacgatgaaa gcgaaaaaca atggaaacat tatttcacgc      1140
     ggcaccatga aagtggagct gaccgatcct tccggcaaag tgaaagcctc ctatgagaag      1200
     tatgtggttg ggcttgtgcc gaaaggggaa agctatccgg aaaaattcgt tttgacactt      1260
     ccgaaaaata cgcctgttgg aaattaccgc ttgactgctt attatcgtgc gggcagaaac      1320
     aataaagccg gagtgaaagt tgccggcaac acaaagatta tttccataaa agataaccgc      1380
     aagagcgctt ccatactgaa tatgccttct tttaaagata tttcttccca ttattgggcg      1440
     aaagaagaca ttgataattt aatcagctta ggagtgatta caggctatca ggacggaacc      1500
     tttaagccgg aagcgcctgt cagccgcctg caggcagcgg cgatgattgt ccgttctctt      1560
     ggattaagca caaaaaatcg gcctgatccg cagctggagg atgtcaagcc tgggcaatac      1620
     ggatatgatg tgatagcgac ggtagtcgat gaaggaattt ttagcggtgc aaacggccgc      1680
     ttccatccga atgccccgct gacaagagag cagatggcga aaattttggt gaatgcttac      1740
     cgcttaacag gggaggaaga agttcacttc cgggatattt cctcatccca atggtcaaaa      1800
     ccgtatattg ccacattatt agccaaccaa gttacccagg ccaatggtct tttccgcccg      1860
     aatgagcgaa cgacgcgcgc tcaatttgcc gcttttgtca gccgttcatt gcgcgcggcc      1920
     gacatggatt aa                                                          1932
//

If you have problems or comments...

PBIL Back to PBIL home page