(data stored in ACNUC7421 zone)

EMBL: CP002293.PE289

CP002293.PE289       Location/Qualifiers
FT   CDS_pept        complement(334315..335223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0299"
FT                   /product="S-layer domain-containing protein"
FT                   /note="PFAM: S-layer domain-containing protein; KEGG:
FT                   bpf:BpOF4_20104 putative S-layer protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73145"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI94"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ADP73145.1"
FT                   /translation="MKRTFLHIALSLLAAMLALPAMNASAATRFSDVNANYWAYNEIHY
FT                   LADKQIIKGQNGKFLPENPIKRMQAAEMLVKALGLSTKNRPNPHFKDIKPGDYGYEYAA
FT                   TLADEGIMTGSNGYFKPWDTLTRGQMAKILSEAYDLTYIFGSDFDDIDEDSWLYDYVSC
FT                   LVDNHITTGYDDNTYRPNDKLKRSQFAAFMARVLEDSFKPAVLFKTVGYDWDEDGGLTL
FT                   LVEVRNNFSYPVEATDALIAVTDNGEWIALDWFEFAPNELRLTAKEAKRIQLYFQPDYV
FT                   LTDPGDLTDITLFSKTEVIKK"
     atgaaacgta catttcttca tattgcttta tcattactgg ccgctatgtt agcgttgcct        60
     gccatgaatg cttccgccgc aacccggttt tccgatgtaa atgcaaatta ctgggcgtat       120
     aacgagattc attatttagc agacaaacaa attatcaaag ggcaaaacgg caaattcctt       180
     cctgagaatc ctataaaacg catgcaagcg gcagaaatgc ttgtaaaagc tttagggctg       240
     agcactaaga accgtcctaa tccacatttc aaagatatta agccaggaga ctatggttat       300
     gaatatgcgg caactttggc ggatgaagga attatgacgg gcagtaacgg ctattttaag       360
     ccatgggaca cgctgacaag aggacaaatg gcaaaaattc tttcagaagc ttatgaccta       420
     acatatatat ttggctctga ttttgatgat attgatgagg atagttggct gtatgattac       480
     gtctcctgtc ttgttgataa ccatattact actggatatg acgacaatac atatcgccca       540
     aatgataaac tgaaaagatc gcaatttgct gcttttatgg cgagagtttt ggaggattcc       600
     tttaaacctg ccgtattatt taaaacagtc ggttatgatt gggatgagga cggcggtctg       660
     actctgttag tagaagtaag aaacaacttc tcttacccgg tagaggcgac agatgcattg       720
     attgccgtta cagacaatgg cgaatggatt gctctcgatt ggtttgaatt tgctcctaat       780
     gaacttcgtt taaccgctaa agaagcgaaa cgaattcagt tgtacttcca gccagattat       840
     gtgcttactg atccgggcga tttaacggat attacgctat tctcaaaaac agaagtaata       900
     aaaaaataa                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page