(data stored in ACNUC7421 zone)

EMBL: CP002293.PE293

CP002293.PE293       Location/Qualifiers
FT   CDS_pept        338335..339165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0304"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="KEGG: bpf:BpOF4_13065 hypothetical protein; PFAM:
FT                   Stage II sporulation protein E; SMART: protein phosphatase
FT                   2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73149"
FT                   /db_xref="GOA:A0A0F6BI98"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI98"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ADP73149.1"
FT                   /translation="MYKYRPTFTQRERVIDNQQIMDNMDKTLQREINLARNIQMQLLNG
FT                   KTPEFEGGEVIGSSLPARLIGGDYYDFYPLVNGKIRIVVGDVMGKGIPAAMLMILTRDA
FT                   FRRVAEITDSPAETLTSMNQALYEDLRTLKSFVTLICADYDPKTGIFTYASAGHHLPLY
FT                   INGRDKTIKELPKVSGIMLGGLPDQVYKEMSIQLDEQDIIFFYTDGIVEAQNKDGEQYK
FT                   LERLVQTLLENHEKSVGEIERSVMDSIHQFTQGVPQKDDITMVLLKVSKQKNGY"
     atgtataagt accgcccgac ttttacccag cgagagaggg tcatagacaa ccagcagatc        60
     atggataaca tggataagac tttgcaacgg gaaattaacc tggcccggaa catacaaatg       120
     cagctgttaa acggaaagac cccagagttt gagggagggg aggtcatcgg ttcctccctt       180
     cccgcaagat taattggggg agattattac gatttttatc ctttagtgaa cggaaagata       240
     cgaattgtcg tcggggatgt tatgggaaaa ggaatcccag cggcgatgct tatgatttta       300
     actcgcgacg ctttccggag agtggcggaa atcacggaca gtccggcaga aaccttaaca       360
     tctatgaacc aggcattgta cgaagatttg cggacattga aatcatttgt gacactgatt       420
     tgtgcggatt acgacccgaa aacgggcatt tttacatacg ccagtgcggg acatcacctt       480
     cctctttata ttaatggccg ggacaaaacg ataaaagaac tgccaaaagt cagtggaatt       540
     atgctgggcg ggcttcctga ccaagtgtat aaagagatgt cgatacaatt agatgagcaa       600
     gatattatat ttttttatac ggacgggatt gtggaagcac aaaataaaga tggagagcaa       660
     tataaattgg aacggctagt acaaacatta ttggaaaacc atgaaaaaag tgtcggcgaa       720
     attgaaagaa gcgtaatgga ctccatccac caatttacgc aaggcgttcc gcaaaaagat       780
     gatataacga tggtcctttt aaaggtaagc aaacaaaaaa atggatatta g                831
//

If you have problems or comments...

PBIL Back to PBIL home page