(data stored in SCRATCH zone)

EMBL: CP002293.PE294

CP002293.PE294       Location/Qualifiers
FT   CDS_pept        339207..341288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0305"
FT                   /product="protein of unknown function DUF342"
FT                   /note="PFAM: protein of unknown function DUF342; KEGG:
FT                   bpf:BpOF4_13070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73150"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="InterPro:IPR032782"
FT                   /db_xref="InterPro:IPR038247"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI99"
FT                   /inference="protein motif:PFAM:PF03961"
FT                   /protein_id="ADP73150.1"
FT                   /translation="MQSIVAKGKDINEAIELGLKLLGTEKEKVSIEIIQTETKGFLGIG
FT                   AKPAIVKLTKLEAAEAQQAPDKNDVIEQAVSEINMEEVAVLSDFLPEREHEGEHQIDTK
FT                   EPDALVGKAWVKNGALFCKTSPTHFPTVTIGEGVKLYRNHELVKEKTTIVTENDVYEIK
FT                   VENEKKDTKWKVWMDEKKLKVFLYVEPGYKITRKLPDIEPSQHIELVVEEYKEVYNTLS
FT                   YADVMQKLESLQVAHQFIRQEQIVKALEAKEPGTYEIAAGVSAKDGKNGWIELNVDLQS
FT                   HNGPIANEDGKVDYREIRTIPSVDRGQVIATIHPPVPGQPGVTVTNEPIPPEPAYPVVL
FT                   QAGRGIMEVDGKIVATESGRPQVKQKGRLVKVSVMPKLTHPGNVDLSSGNIRFTGDVEI
FT                   FGEVEKNMVVEAKGDIIVHQTVNMASLIASGAIVSYGNIISSEISAGKHNMLVAELGNL
FT                   LGIIQQNMEKMIGVIRQLLQSPAFKSNDFSRGGLQPLIRILLEKKFQSFPPFVKKYVEM
FT                   VRNGESDLEDDGWKEIADSLTKLFLSLTNEVISLEWMIQLSQKMKELHKTSVSPAEPDS
FT                   YISIPSALNSRIYCGGDVFVTGKGGCINTKIHAGGALKINGVVRGGEVYGGLGAEINET
FT                   GSERGISTVIAVPRDQKIRINKAMEGTVLKIGNAKYTLKETRHYVSARLDQDDRIVFE"
     atgcaaagta ttgttgcaaa agggaaagat attaacgaag cgattgaact tggtttaaag        60
     ttattgggaa cggaaaaaga aaaggtcagt attgaaatca ttcagactga aacgaaaggt       120
     tttttaggca tcggcgcgaa accagcgatt gtgaaactga cgaagctgga agcggctgag       180
     gcgcagcaag ctcctgacaa aaatgatgta atcgagcaag cggtttcgga aataaatatg       240
     gaagaagttg ctgtactatc tgactttttg ccggagcggg aacacgaagg cgaacatcag       300
     attgacacaa aggaaccgga cgctcttgtc ggcaaagcgt gggttaagaa tggagcgttg       360
     ttttgcaaaa cgtccccgac tcattttccg acagtaacga ttggcgaagg agtaaaatta       420
     taccgcaatc atgaactggt gaaagaaaaa acgacgattg tgacagaaaa tgatgtgtac       480
     gaaataaaag tggaaaacga aaaaaaggat acaaaatgga aagtttggat ggacgagaaa       540
     aaattaaaag tgtttttata tgtggaacct ggttataaaa tcacccgcaa actgccggat       600
     atcgaaccaa gccagcacat tgagctggtt gttgaagaat ataaggaagt ttataacacg       660
     ctaagttatg ctgacgtaat gcaaaagtta gaatcgctgc aagtggcaca tcaatttatt       720
     cgtcaagaac aaatcgtgaa agcccttgaa gcgaaagaac cgggcactta cgaaattgcg       780
     gccggcgtaa gcgccaaaga tggcaaaaat ggctggattg aactgaatgt cgatttacaa       840
     tcccacaacg gtccgattgc caatgaagat ggaaaagtcg attaccggga aatccggacc       900
     attccatcag ttgacagagg gcaagtgatc gcgaccattc atccgcccgt gcctggccag       960
     ccgggagtaa cggtaaccaa tgaacctatc ccgcccgagc cagcttatcc tgtagttctc      1020
     caggcaggaa gaggaatcat ggaggtcgat ggcaagatcg ttgcgacgga atccgggcgc      1080
     ccgcaagtaa aacaaaaagg acgtcttgta aaggtttccg ttatgccaaa attaactcat      1140
     cccgggaatg tcgatttatc gtctggcaat atccgtttta caggggatgt cgagatattc      1200
     ggcgaagtgg agaaaaacat ggttgtcgaa gcaaaaggag atatcattgt tcatcaaacc      1260
     gtcaatatgg cttcacttat tgcttccggg gcgatcgttt cctatggtaa tattatcagt      1320
     tcggaaattt ccgcgggaaa acataatatg ttagtggcgg aattgggaaa tttgcttggc      1380
     attatccagc aaaacatgga aaaaatgatc ggtgtgatcc gccagcttct ccaatctcct      1440
     gcttttaaat ctaacgattt ttccagaggc ggtctgcagc cattaatccg gatattgctg      1500
     gagaaaaagt ttcagagctt tccgccattc gtcaaaaaat acgtggagat ggttagaaat      1560
     ggagaaagtg atttagagga tgacggatgg aaggaaatcg cggattcttt gacaaagctt      1620
     ttcttgtctt taaccaatga agtgatttct cttgaatgga tgattcaatt atcgcaaaaa      1680
     atgaaagaac ttcataaaac cagtgtgtct cccgctgaac cggattctta tatctctatt      1740
     ccgagcgccc tcaatagccg gatttattgc ggcggcgatg tgtttgtcac tggcaaggga      1800
     ggatgcatta atacgaagat tcatgccggt ggtgcattaa agatcaatgg tgtcgtccgc      1860
     ggtggagaag tgtatggagg tttgggagcc gaaattaacg aaacaggatc ggaacgggga      1920
     atatcaacgg tcattgccgt tccgcgtgac caaaaaatta gaattaataa ggcgatggaa      1980
     ggaacagtcc tgaaaatcgg aaacgcgaaa tatacattaa aagaaacgag acattatgtg      2040
     tccgcgcgtc tagatcagga tgaccggatt gtgttcgagt aa                         2082
//

If you have problems or comments...

PBIL Back to PBIL home page