(data stored in ACNUC7421 zone)

EMBL: CP002293.PE296

CP002293.PE296       Location/Qualifiers
FT   CDS_pept        complement(341811..342998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0307"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: gwc:GWCH70_3058 efflux transporter, RND
FT                   family, MFP subunit; TIGRFAM: efflux transporter, RND
FT                   family, MFP subunit; PFAM: secretion protein HlyD family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73152"
FT                   /db_xref="GOA:A0A0F6BIA1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIA1"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADP73152.1"
FT                   /translation="MKRWKRYIFLVIVLCICANFYMLFHEHSKIPKSVYVNERTKPEKT
FT                   TIKETVRTGGFTAPAERKFVYYDPQLGVIDEILVAKGQEVQVGTPLIRYADADIDREIQ
FT                   RIALKKEQLHAQIEQLAKDIDHYTTLSSSAEEEDSMKIQWEEKAREAEREKTLFEWKIK
FT                   EYEEQQNELTEKKDELVVESKTAGIIEEISYDKSKPLITIASPSAIVRGKAKEGTIEKL
FT                   AIGQAAVVRVPNEKESFAGTIAAIGKIPVKEASFQEKSEYPFTVQLNEQPKQLPFGYHV
FT                   NITVVTKEKSGAITIPAEAVWREKTKSFVYVIHNGKLEKRKVTLGIAHGEKQEIEQGLR
FT                   ENEYIVSHPAKQMKHGMDVIVPLDLEKPTKETIKQLSKWDIVKHFLDGFFRSFHS"
     atgaaacgat ggaagcgata tatattcctt gtcatcgtat tatgcatatg cgcgaacttt        60
     tatatgttgt tccatgaaca tagtaaaatt ccaaaatcgg tttatgtgaa cgaacggaca       120
     aaaccggaga aaacgaccat caaagaaacc gtccgcactg gcggcttcac cgcgccggca       180
     gagcggaaat tcgtttacta cgatcctcag ctcggcgtca ttgatgaaat tcttgtcgcc       240
     aaagggcaag aagtgcaagt cggcacaccg ctgatccgct acgcggacgc ggacatcgat       300
     cgcgagattc agcgaattgc cctgaaaaaa gaacaattac atgcgcaaat cgaacagctt       360
     gccaaagata tcgatcatta tacaacactg tcttcttcgg ccgaagaaga agacagcatg       420
     aaaatacagt gggaagaaaa agcgagagaa gcggagcggg aaaaaacgct gttcgaatgg       480
     aaaataaagg aatatgagga gcaacaaaat gaactaacag agaaaaaaga cgaactggtc       540
     gtggaaagca aaacggccgg catcatcgaa gaaatcagct atgacaagtc gaaaccgctg       600
     atcactatcg cttctccttc cgccatcgtg cgcggaaaag cgaaagaagg gactatcgaa       660
     aaactcgcta tcgggcaggc ggcggttgtc cgcgtcccga acgaaaaaga atcctttgcc       720
     ggcacgattg ccgccatcgg caaaattccg gtcaaggaag cgagctttca agaaaaaagc       780
     gaatatccgt ttactgtgca gctgaacgaa cagccgaaac aacttccttt cggatatcac       840
     gtaaacatca cggtcgtgac aaaagaaaaa agcggggcga tcaccatccc tgccgaagcg       900
     gtatggcggg aaaaaacaaa atcgttcgtc tatgtcattc ataacggaaa actggaaaaa       960
     cggaaggtga cgcttggaat cgcacatgga gaaaaacaag aaatcgagca aggtctccgt      1020
     gaaaacgaat atatcgtatc ccatccggca aaacagatga aacacggaat ggacgtcatt      1080
     gttccattgg atctggaaaa gccaacaaaa gaaacaatca agcaattatc gaaatgggac      1140
     atcgtcaagc acttccttga cgggtttttc cgttcgttcc atagctga                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page