(data stored in SCRATCH zone)

EMBL: CP002293.PE298

CP002293.PE298       Location/Qualifiers
FT   CDS_pept        complement(344033..345775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0309"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73154"
FT                   /db_xref="GOA:A0A0F6BIA3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIA3"
FT                   /inference="similar to AA sequence:KEGG:BMD_5208"
FT                   /protein_id="ADP73154.1"
FT                   /translation="MLKNGIFSAIAALASAICTVLFFSPIHWNILAEGGILFLLLFAAY
FT                   YIVLQNKTRFVAPLSRSKRWAAGLFMLLFPLFTVISMKGEQTHLQHSPLAVKFVIYIGT
FT                   YVSIIMLTLFIVSLILSVTPDRPDPGKKWGYIFVYALPPLIVWAFYLIAFFPGAMTADS
FT                   IFQWEQAHTGKFNDWHPLMYTLFIMLVTSVWDSPAAIGIAQIIIISLVIGYCLFELEKA
FT                   GAPKWAVWAVSILFAVSPINGIYSITVWKDILYSTFILLFTTLIGKLIMTNGDWLKRFP
FT                   AFIFFTVTALGVVFFRHNGFVVCLATLIILSAAFRHLWKQWLLVLSLVVAIHYAVTGPL
FT                   FAYLKVTPSDPNEALSIPTQQIARVITYNGKMTEQQAEYIHKIMPLDLWKKLYNPYLTD
FT                   PIKFSRHYNRQAIFPDHLSTYLQTWWEICRQNPRLVIEAMAKQTSLVWQMNEPKDGYTS
FT                   MFVTNVFYGNKFGLKNEVIFQPITKTVGTYLKWSETAGKPFIWRPAVYMFFIILFTFIA
FT                   FLRNDRKALLLPIAVLLNIGTVFIALPAQDFRYLYSNSLVFFIAFLFALVSYRNDGNTL
FT                   SQKR"
     atgttgaaaa atgggatttt cagcgccatc gcggcattgg caagcgccat atgtactgtt        60
     ttattttttt ctcctattca ttggaacatc ctagcagaag gaggaatctt atttctcctt       120
     ctatttgctg cttattatat agtgctgcaa aacaaaacgc gctttgttgc gccgctttcg       180
     cgatccaaac gatgggcagc ggggctgttt atgctattgt ttccactttt caccgtcatc       240
     agcatgaaag gcgaacaaac gcatttgcag cactccccgc tggctgtgaa gttcgttatt       300
     tatattggaa cttatgttag tataattatg cttaccttat tcattgtttc actgattctg       360
     tccgtcaccc ctgaccgtcc tgatccgggc aaaaaatggg ggtacatttt tgtttatgcc       420
     ttgcctccgc ttattgtttg ggcgttttat ttaatcgcct ttttcccggg cgcgatgaca       480
     gcggattcga tatttcagtg ggaacaagcc cataccggaa aattcaatga ctggcatccg       540
     cttatgtaca cactttttat tatgctagta acatcggtat gggactctcc ggccgcgatc       600
     ggaatcgcgc aaatcatcat tatttcgctt gttattggct attgcctgtt cgaattagaa       660
     aaagcagggg cgccgaaatg ggcggtttgg gctgtttcca ttttatttgc cgtcagcccg       720
     atcaacggca tttattccat caccgtctgg aaagatattt tatacagcac gtttattttg       780
     ctgtttacaa cgctaatagg caaacttatt atgacaaatg gagattggct gaagcggttt       840
     ccagctttta tcttctttac agtcaccgca ttaggagttg tttttttccg gcataacgga       900
     tttgttgtct gtttagcaac gctgatcata ttatccgcgg cgttccgcca tctctggaaa       960
     caatggcttc tcgtcctttc gctggtagtg gccattcatt atgccgtcac aggcccttta      1020
     tttgcctatt tgaaagtgac gccgtctgat ccaaatgaag cgttaagcat tccaacccag      1080
     caaatcgccc gcgttatcac gtataatgga aaaatgaccg agcagcaagc cgaatatatc      1140
     cataaaatca tgccattaga cttatggaaa aaattataca atccttactt gactgatccg      1200
     attaaatttt cccgccacta taataggcaa gcaatttttc cggatcatct ttccacttac      1260
     ttgcaaacat ggtgggaaat ttgccggcaa aatcctcgac tcgtgatcga ggcgatggcc      1320
     aagcaaactt ccctcgtctg gcaaatgaac gaaccgaagg atggatacac gtccatgttc      1380
     gttaccaacg ttttttacgg aaacaaattc ggcttaaaaa acgaagtaat ttttcagcca      1440
     atcactaaaa cagtcgggac atacttaaaa tggtcggaaa cggcaggcaa accgtttatt      1500
     tggcgtccgg cagtatatat gtttttcatc attttattca catttattgc ctttttgcgg      1560
     aacgaccgga aagcattgct tcttccgatt gctgtgcttc tcaacatcgg gaccgtattt      1620
     atcgctttgc cggcgcaaga tttccgttac ttatattcca attccctcgt attctttatc      1680
     gcgtttttat ttgccttggt ttcgtaccgc aacgatggca atacgctctc acaaaaaaga      1740
     taa                                                                    1743
//

If you have problems or comments...

PBIL Back to PBIL home page