(data stored in ACNUC7421 zone)

EMBL: CP002293.PE30

CP002293.PE30        Location/Qualifiers
FT   CDS_pept        42903..43652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0030"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG: gwc:GWCH70_0030
FT                   methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72886"
FT                   /db_xref="GOA:A0A0F6BHI5"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHI5"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ADP72886.1"
FT                   /translation="MVELYDDERLDYLLHEEIRIIQSPSVFAFSLDAVLLAKFAYMPIQ
FT                   KGLIVDLCTGNGVIPLLLSMRTKGKIIGVEIQERLCDMAKRSVKYNGLEKQIEIIHGDI
FT                   KDAPKQLGYSKYDVVTCNPPYFPTISKEEMNKNVHLAIARHEIYCTLEDVVRVSSQLLK
FT                   QGGKAAFVHRPGRLLDIITLMREYRLEPKRLRFVYPKAGKEANTILIEGIKDGNPDLKI
FT                   LPPLIVYNDDNEYTDEVKQLLYGIIPS"
     atggtggaat tgtatgacga tgagaggctt gactatcttt tgcatgaaga aatccgcatt        60
     attcaaagtc cgtcggtgtt tgctttttcc cttgatgcgg ttttgctggc gaaatttgct       120
     tatatgccga ttcaaaaagg gcttattgtc gatttatgca cgggaaacgg cgttattccg       180
     ttgttattaa gcatgagaac aaaagggaaa attatcgggg tagaaattca agagcggctt       240
     tgcgacatgg caaaaagaag cgtaaaatat aacggtttgg aaaaacagat cgaaattatc       300
     catggagata ttaaagatgc gccgaagcaa ttaggatata gtaaatatga tgtcgttaca       360
     tgcaatcctc cttattttcc aacaatcagc aaggaggaaa tgaacaaaaa tgttcattta       420
     gccattgccc gccatgaaat ttattgtacg cttgaagatg tggttcgcgt aagcagccag       480
     ctgttaaaac agggcggtaa agccgcattt gtgcaccgac cgggaaggct gcttgacatt       540
     attacgctaa tgcgcgaata tcggctagag ccaaagcggc tgcggtttgt ttatccgaag       600
     gccggaaaag aggcaaatac gattttgatt gaaggcatta aagacggcaa tccggattta       660
     aaaattttgc cgccgcttat tgtatataat gacgataatg aatatacgga tgaagtgaaa       720
     cagctgttat atggaatcat cccatcgtaa                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page