(data stored in ACNUC7421 zone)

EMBL: CP002293.PE301

CP002293.PE301       Location/Qualifiers
FT   CDS_pept        complement(350146..350493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0312"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: membrane protein, transporter of
FT                   cations and cationic drugs"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73157"
FT                   /db_xref="GOA:A0A0F6BIA6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIA6"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADP73157.1"
FT                   /translation="MNTFIQSIKKNKIGIILILLASVSTASGQMFWKLSGGQWNRHLIL
FT                   GFLFYGIGAILMTIAFRFGSLSVLHPLLSMGYVFALLLGVTFLDEHITATRAMAVVLIV
FT                   TGAVLIGGGDD"
     atgaacacgt ttattcaatc cattaagaaa aacaaaattg gtatcatcct tattttgctg        60
     gcatctgtaa gcaccgcaag cggccagatg ttttggaaat tatcaggagg gcagtggaac       120
     cgccacttaa ttttagggtt tctcttttac ggcatcggcg ccatcctcat gaccatagcc       180
     tttcgcttcg ggagcctgtc tgtgcttcat ccgcttttaa gcatggggta tgtattcgcg       240
     cttttgcttg gagttacttt tctcgatgaa cacattaccg cgacgcgggc aatggcagtc       300
     gtattgattg tcaccggcgc tgtccttatc gggggtgggg acgattaa                    348
//

If you have problems or comments...

PBIL Back to PBIL home page