(data stored in SCRATCH zone)

EMBL: CP002293.PE303

CP002293.PE303       Location/Qualifiers
FT   CDS_pept        352019..354313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0314"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; S-layer domain-containing protein; KEGG:
FT                   afl:Aflv_2606 subtilisin-type proteinase with two SLH
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73159"
FT                   /db_xref="GOA:A0A0F6BIA8"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIA8"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ADP73159.1"
FT                   /translation="MRNPLLFMCCLLIGFIFLFEKDVHSQSLSEWVVYFQSEKDYSLFM
FT                   EKYRDRVKDQEKEKQWAVKALFTKEEIGGIQKLSIVSKVEPNYQKSLASSFFNDPLVSQ
FT                   QWGINKIDILSVASKFQQRNMLIGKQIATAQGVMAYEGQPLPMLSFSVLSEEEMKLSRL
FT                   SATVDHVENTWTLQVTDKDGKVLAQNSGNLSTLDVLLPKNQTYKTLQIHIQANGWKKPP
FT                   VITNMTAVNHVLVAVIDTGAALHKDFCGNVLHSLGKDYVHPGRLALDDHGHGTHVTGII
FT                   AACANNHEGIVGAAGFAPVDVVPFKVLDREGTGGDFEIAKAVNDAVSMGADVINLSLAG
FT                   KGKTLVLEQAVQNALQHHVVVVAAAGNWGISLQDVYPASYPGVIAVAAVDEHNQIASYS
FT                   DYGWKLDISAPGDNILSTFINNEYRTLSGTSMAAPFVSGVAALLKATDPRLDDIQIRKR
FT                   LFESAEDIQEKGYDIHSGYGVVQAAKAIQLPYSEAVDWLTIKSGQPLSFSEKQILGISK
FT                   GLIGKDVYVFIDDQLVEKRNMDDQWLSFALPDVPSARNEKKLTVVGADHTGKVAAFDER
FT                   WVNSAASASASFSDVPSSFWAYEEIQTAYREKWINGFTDHTFRPNALLTRRHAVMMMNR
FT                   LFQWRPQQIRSPFLDTPLTLAGALPIYAAYGQRIVKGYDDGHFYPERFVTRAQMAVMLA
FT                   RALKLSEDSFSGTPYAFKDMDGSFAYYAVQQLADKGIVTKQPYFRPNEFLTRAQFAAML
FT                   ARTYQYMLDKK"
     gtgcgaaatc ctttgttatt catgtgttgc ttattaattg gctttatatt cttgtttgaa        60
     aaagacgtac acagtcagtc attgtctgaa tgggtggttt attttcagag cgaaaaagat       120
     tattcgctat ttatggaaaa atacagagat agagtaaaag atcaggagaa agaaaagcaa       180
     tgggcagtaa aagccctgtt tactaaagag gaaatcggcg gaattcaaaa gctttccatc       240
     gtctcaaagg tagaaccgaa ttatcaaaaa tcgcttgctt cttctttttt taatgaccct       300
     cttgtttctc aacaatgggg aatcaataaa atagatatat tgtccgtagc ctctaaattt       360
     caacagcgca atatgttaat aggaaaacaa atcgccactg ctcaaggcgt gatggcatat       420
     gaaggtcagc cattgcctat gctgagcttt tcggttttgt cagaggaaga aatgaaactg       480
     tcccggttat cggccacggt ggatcatgtg gagaatacat ggacacttca agtgacggat       540
     aaggacggaa aggtgctcgc gcaaaatagc ggcaacttgt caacattaga tgtgctttta       600
     ccgaaaaacc aaacatataa gacgctgcaa atccatattc aagcaaacgg atggaaaaaa       660
     cctcctgtta tcactaatat gacagcggtc aatcatgtgc ttgttgctgt gattgatacg       720
     ggagcagcgc tgcataaaga cttttgcgga aatgttcttc atagtttagg gaaagattat       780
     gtccatccgg gacggctggc gctggacgac catgggcacg gcacgcatgt gacaggaatt       840
     atcgcagctt gcgcgaataa tcatgaggga attgtcgggg cagcgggatt tgctcctgtt       900
     gacgttgttc ctttcaaggt gcttgatcgt gaagggacgg gaggggattt tgaaattgcc       960
     aaagctgtca atgacgctgt atcaatgggg gcggatgtca ttaatttaag cttggcgggg      1020
     aaaggaaaga cgcttgtttt ggaacaagcg gttcaaaatg cacttcaaca tcatgttgtt      1080
     gtcgtagcag cggcaggcaa ttgggggatt tcattacagg atgtttatcc tgcgtcatat      1140
     ccaggagtga ttgctgttgc ggcggtagat gaacacaatc aaattgcctc ttattcagac      1200
     tacggatgga aactggatat tagcgcgcct ggcgacaata tcctcagcac ctttattaat      1260
     aatgaatatc ggacgttaag cggaacttcc atggctgcgc cttttgtgtc aggtgtggcg      1320
     gcgttattaa aggcaacgga tccgcgcttg gacgatatac aaatccgtaa gcggctgttt      1380
     gagtcagcgg aggatataca ggaaaaagga tatgatattc attcgggata tggcgtggtg      1440
     caggcggcaa aagccattca gcttccgtac agcgaagcgg tggactggtt gacgatcaaa      1500
     agcggccagc cgctgtcatt ttcagaaaaa cagattctcg gcatttcgaa aggattgatt      1560
     ggcaaagatg tgtatgtgtt tatcgatgat cagttagtag aaaaacgaaa catggatgat      1620
     caatggcttt cctttgcatt gcctgatgtg ccgtcggcta ggaatgagaa aaagctgacg      1680
     gttgttggcg cggatcatac cggaaaagta gctgcttttg atgagcgctg ggtgaattcg      1740
     gcggcatccg catccgcttc cttttctgat gtcccatcct cattttgggc atatgaagaa      1800
     attcaaacgg cgtaccgtga aaaatggatt aacggtttta ccgatcatac atttcgccct      1860
     aacgctctgt taacgcggag gcacgctgtg atgatgatga atcggctgtt tcaatggcga      1920
     ccgcagcaaa ttcgttcccc ttttcttgat acgccgttga cattggcagg ggcgttgccg      1980
     atttacgctg catatggcca gcgcattgtg aaaggatatg atgatggaca tttttatccg      2040
     gaacggtttg tgacaagggc gcaaatggcg gtgatgctgg caagagcatt aaaattaagt      2100
     gaagactcgt tttctggcac tccttatgcg tttaaagaca tggatgggag ttttgcttat      2160
     tatgcggtgc agcagctggc agataaagga attgtcacga agcagccgta ttttcgccca      2220
     aatgagtttc ttacccgcgc ccagtttgcg gcaatgcttg caagaacata tcaatatatg      2280
     ttggataaaa aataa                                                       2295
//

If you have problems or comments...

PBIL Back to PBIL home page