(data stored in ACNUC7421 zone)

EMBL: CP002293.PE305

CP002293.PE305       Location/Qualifiers
FT   CDS_pept        356052..356168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73161"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIB0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP73161.1"
FT                   /translation="MVRKRNRGYSQKVGLDDLLRQPLYAVCLEKFVGLGLRF"
     atggtaagaa aaagaaacag aggctactct caaaaggtcg gtttagacga ccttttgaga        60
     cagcctcttt atgccgtttg tttggaaaag tttgtcggat tagggttgcg attttag          117
//

If you have problems or comments...

PBIL Back to PBIL home page