(data stored in ACNUC7421 zone)

EMBL: CP002293.PE308

CP002293.PE308       Location/Qualifiers
FT   CDS_pept        359127..360188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0319"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG: mth:MTH450
FT                   LPS biosynthesis RfbU related protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73164"
FT                   /db_xref="GOA:A0A0F6BIB3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIB3"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADP73164.1"
FT                   /translation="MYPTETAKSFGIFVKNQVEALRGRGLHVDVIAVTNPRTDKVNVLT
FT                   KYILWLLRTLIHCVTKGRNYDVVHAHYVFPTGMLGLWYKKWWKAKLVVTAHGGDIDRMA
FT                   NKSGRIRQWTTTILREADHVIAVGHKLAEQIRNEFGVPEENVSVINMGVNRRIFQPLDK
FT                   EEARKRCGIGEHEIPILFVGNIIRQKGLIELVEAFSKLKKEYHSVSLYLIGAKKDNAFY
FT                   HELIHRVKEAEINDVHILDAMQQKDVAVWMAAAEMFVLPSHLEGFGLVALEAMSCHTPV
FT                   VGSRVGGLAYLLGDGAGVLVEPGNPDSLFEGMKKLLDDAALRKQLVQKGEARAQENDQE
FT                   RIIDQILQLYDRV"
     atgtatccaa cagaaacggc aaagtcattt ggcatttttg tgaaaaatca agtggaagct        60
     cttcgcggcc gcgggctgca tgtggatgtt attgctgtaa cgaatccgcg cacagataaa       120
     gtaaacgtcc taacgaaata tattttgtgg cttcttcgaa cattgattca ttgtgtgaca       180
     aaagggcgga attacgatgt ggttcatgct cattacgttt ttccgacagg aatgctggga       240
     ttatggtata aaaaatggtg gaaggcaaag ctggttgtga ctgctcatgg cggggatatt       300
     gaccgaatgg ctaacaaaag cggaaggatt cggcagtgga caacgaccat tttgcgggag       360
     gcggaccatg tcatcgcggt ggggcacaaa ctcgctgagc agattcgcaa tgaatttggt       420
     gttcctgagg aaaacgtctc tgtgattaac atgggcgtta accgccgcat atttcagccg       480
     cttgacaaag aggaagcgag aaagcgctgc gggatcggcg aacatgagat tccaatttta       540
     tttgtgggaa atattattcg ccaaaaagga ctaatcgaat tggtggaagc attttcgaaa       600
     ctgaaaaagg aataccattc cgtctcgctt tatctgattg gcgctaagaa ggataacgcc       660
     ttttatcatg aactcattca tcgcgtgaag gaagcggaaa tcaatgatgt acatatattg       720
     gacgcgatgc aacagaaaga tgtagcggtg tggatggccg ctgcagagat gtttgtgctg       780
     ccgtctcatt tagaaggatt tggattggtg gcgttagagg cgatgtcttg ccatacgcct       840
     gttgtcggaa gccgtgttgg cggactggct tatctgcttg gtgacggggc aggtgtgctt       900
     gtggagccag gcaatccaga ttccttgttc gagggaatga aaaaattgct tgatgatgcg       960
     gctcttcgca aacagctagt tcaaaagggc gaggcgcgcg cccaagaaaa tgatcaagag      1020
     agaatcattg accaaattct ccagctttat gaccgtgttt aa                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page