(data stored in SCRATCH zone)

EMBL: CP002293.PE309

CP002293.PE309       Location/Qualifiers
FT   CDS_pept        360253..361758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0320"
FT                   /product="integral membrane protein MviN"
FT                   /note="KEGG: drm:Dred_3098 integral membrane protein MviN;
FT                   TIGRFAM: integral membrane protein MviN; PFAM: virulence
FT                   factor MVIN family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73165"
FT                   /db_xref="GOA:A0A0F6BIB4"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIB4"
FT                   /inference="protein motif:TFAM:TIGR01695"
FT                   /protein_id="ADP73165.1"
FT                   /translation="MNRKRLFQIIGVVTVINILSRFFGFVREVMIGYHFGTSSLADSVV
FT                   LAYTIPNFLYLVLGGAVTTAYISIFSKMANDIEKQRFHNTVFTYMLIFLLLITAGLMVF
FT                   AKPIVAFFFSGLAGSQLLMTSQLFMITAPSALFLVFSMWFSGILNAQDQFYGAAVAALV
FT                   NNGMFVLLVVLLYPFCGIYAYGWGAVASAAVMLLILFVQLRKNNLHRFQFQLVTTEPEY
FT                   IARMLKIAVPVLFGGATLQLYIFIQRMFASQLEAGYVAALNYALKFVQLPQVILMTSVT
FT                   TVIYPMLAKKTAEKDYGGISSIFFRGLKSLFMIIVPVSVFVYFYAEEMVKLIFEYGSFT
FT                   AQSTKMTAMMLKIFIIGMFAQAANLFITRFFYAMEKSFVPVATGMISVFGVNILIIKLF
FT                   IGKYGADAVAWGTTVSAIVQFLMLAVASVVQLRLQPEKEAQWLRLILYALCATIAAAII
FT                   HKYIDFHHHIANIFIGGLTFVLVSLLLLKSFRLMSFQRLPMMK"
     gtgaacagaa aacgtctgtt tcaaatcatt ggtgtcgtaa cggttattaa catattgtcg        60
     cggtttttcg ggtttgtgcg tgaagtgatg attggatatc attttggcac gtcctcattg       120
     gcagacagtg ttgttttggc ctataccatt ccgaactttt tgtatttagt gcttggcggg       180
     gcggttacga ccgcctatat tagtatcttt agcaaaatgg caaacgatat agagaagcag       240
     cgctttcaca ataccgtatt tacgtatatg ctgattttct tattattgat cacagcagga       300
     ttaatggtgt ttgcaaaacc aattgtcgca ttcttttttt ccggcctcgc cggttcacag       360
     ttgctgatga cgtcgcagct ttttatgatt acagcccctt ctgcgctatt tcttgttttt       420
     tcaatgtggt tttctggcat tttaaacgcg caagatcaat tttatggcgc tgccgttgcg       480
     gcattggtga ataacggaat gtttgtgctg ctggtcgtgc tgctttatcc tttttgcggt       540
     atttatgcat atggatgggg ggcggtggcg agcgccgcgg tgatgctgct gattttgttt       600
     gttcagctgc ggaaaaataa cttgcaccgc tttcagtttc aattggtgac gacggaaccg       660
     gagtacatcg ccagaatgtt aaaaattgcg gtacccgtct tgtttggcgg tgcgacgctg       720
     caattatata tttttattca gcgcatgttt gcctcacagc ttgaggctgg gtatgtggcg       780
     gctttaaatt atgctttgaa atttgtccag ttgccgcaag tgattttaat gactagcgta       840
     acgacagtga tctacccaat gcttgccaaa aaaacagcgg agaaggatta tggcggcatt       900
     tcatcgatat ttttccgcgg gctgaaatcg ctgttcatga ttattgttcc tgtttcggtt       960
     tttgtttatt tttacgccga agaaatggtg aagctgattt ttgaatatgg atcatttacg      1020
     gcgcaatcga caaaaatgac ggcgatgatg ctgaaaattt tcatcattgg gatgtttgcc      1080
     caagctgcca atctgtttat tacacggttt ttttatgcga tggagaaatc atttgttcct      1140
     gtagcgactg gaatgatttc cgtatttggc gtcaatattt tgattattaa gctgttcatc      1200
     ggaaaatatg gggcggatgc tgtggcatgg ggaacgacgg ttagcgccat tgtccaattt      1260
     ctcatgctgg ctgttgcaag cgtcgtgcag ttgcgccttc aaccggaaaa agaagcacag      1320
     tggcttcggc ttatcttgta tgctctttgt gcaacgattg ccgcggcaat aattcataaa      1380
     tatatcgatt ttcaccatca tattgccaat atttttatag gaggtctcac gtttgttctc      1440
     gtttctcttc ttttgctgaa atcattccgc ttgatgtctt ttcaacggct gccgatgatg      1500
     aaatag                                                                 1506
//

If you have problems or comments...

PBIL Back to PBIL home page