(data stored in ACNUC7421 zone)

EMBL: CP002293.PE31

CP002293.PE31        Location/Qualifiers
FT   CDS_pept        43667..44545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0031"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: gwc:GWCH70_0031
FT                   uroporphyrin-III C/tetrapyrrole (corrin/porphyrin)
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72887"
FT                   /db_xref="GOA:A0A0F6BHI6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHI6"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ADP72887.1"
FT                   /translation="MLWQQKSFEDNHKGTLYIVPTPIGNLEDMTFRAVRILQEVDMIAA
FT                   EDTRQTKKLLNHFQIRTPLISYHEHNKYTSGPQIVERLKAGESVALVSDAGMPGISDPG
FT                   HELVVSALEERCPVVPLPGANAALTALVASGLSTNHFYFFGFLERTKKEKKEQLESLKK
FT                   IRETMIFYEAPHRMQETLMMMHEVFGERRVVLCRELTKRFEEFIRGNLSEIVEWVSIHE
FT                   IRGEFCIVVEGAKETQEDEKTEAWWHSLTPVEHVEYYIREKNFTTKEAIKQTAKDRNMS
FT                   KREVYRQYHRQ"
     atgctttggc agcaaaaaag ttttgaagat aatcataaag gaacgctata tatcgttccg        60
     acgccgatag gcaatcttga agatatgacg ttccgggcgg tgcgcatttt gcaagaagta       120
     gatatgattg ccgcggaaga tacaaggcaa acgaaaaaac tgttaaacca ttttcaaatc       180
     cgtacgccgc tcattagtta tcatgagcat aataaatata caagcgggcc gcaaattgtg       240
     gagcgtctga aagcgggaga atccgtagcg ctcgtcagcg acgcgggaat gccgggaatt       300
     tcagatccgg gccatgagct ggttgtttct gcccttgaag agcggtgtcc tgttgtcccg       360
     cttccgggtg caaacgcagc gttaactgcg cttgttgcat cggggctgtc gacaaaccac       420
     ttttactttt ttggctttct tgaacggacg aagaaagaaa aaaaggaaca gttggaatca       480
     ttgaaaaaaa ttcgggaaac gatgattttt tatgaagctc ctcatcgcat gcaagaaacg       540
     cttatgatga tgcatgaagt gttcggcgag cgccgcgttg ttttatgtcg agaactgacg       600
     aaacggtttg aagagtttat tcgcggcaat ctgagcgaga ttgtcgaatg ggtaagcatt       660
     cacgagattc gcggggaatt ttgcattgtt gtggaagggg caaaggaaac acaggaagat       720
     gaaaaaacgg aagcatggtg gcattcgcta accccggtcg agcatgtcga atattatatt       780
     cgggagaaaa attttacgac aaaagaagcg ataaaacaaa cggcgaaaga tagaaatatg       840
     tcgaagcggg aagtgtaccg gcaatatcac cgccaataa                              879
//

If you have problems or comments...

PBIL Back to PBIL home page