(data stored in ACNUC7421 zone)

EMBL: CP002293.PE311

CP002293.PE311       Location/Qualifiers
FT   CDS_pept        complement(363240..364217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0322"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="KEGG: gwc:GWCH70_3046 cell envelope-related
FT                   transcriptional attenuator; TIGRFAM: cell envelope-related
FT                   function transcriptional attenuator, LytR/CpsA family;
FT                   PFAM: cell envelope-related transcriptional attenuator"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73167"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIB6"
FT                   /inference="protein motif:TFAM:TIGR00350"
FT                   /protein_id="ADP73167.1"
FT                   /translation="MVDERTTINGRKRYKKKKKKKRRRRILFGLFMLSLLLLVSSLGYA
FT                   SFLLHKAESVMNKSYEMLRYDNAESLDPKKDNFSVLFIGVDDSRTRNFQKDTRSDALIL
FT                   ATFNAKDQSVKMVSIPRDSYVYIPCEDKYDKITHAHAYGGVKCTVETVENLFDIHINYY
FT                   VKMNFYAFMDVVDALGGIEVEVPYNIKEKDSEDHHNAIVLKKGLQKLNGEEALALARTR
FT                   KKDNDIERGKRQQEILKAILKKASQASSITKYDDVIEAVGNNMKTNFTFDQIKSLVYYV
FT                   VSNKNLSIESLHLTGTDSNDGVYYYMLDEQSVQEISETLQNHLR"
     atggtagatg aaagaacgac aataaatgga cgaaagcgat acaaaaagaa aaaaaagaaa        60
     aagcgaagaa gacgcatttt attcgggctg tttatgctca gcttattatt gttagtcagt       120
     tctttaggat atgcttcatt tttgctgcat aaggccgaat cggtgatgaa caagtcatat       180
     gaaatgctca gatatgataa cgccgagtct cttgacccaa aaaaggataa tttttctgtg       240
     ctgtttattg gcgtcgatga cagccgcacg cgcaattttc aaaaagacac cagatctgat       300
     gcgctgattc tcgccacatt taacgcgaaa gaccaatctg tgaaaatggt gagcattccg       360
     cgcgactcat acgtatatat tccatgtgag gacaaatatg ataaaattac gcacgcacat       420
     gcttatggag gcgtaaagtg caccgttgaa acagtcgaaa atttatttga tatccacatc       480
     aattattacg tcaaaatgaa tttctatgcc ttcatggatg tcgtcgatgc gttgggcgga       540
     atcgaagttg aagtgcctta taacattaaa gaaaaagatt cagaagacca tcataacgcc       600
     attgtcctga aaaaagggct tcaaaagtta aacggcgaag aagcgctcgc ccttgcgaga       660
     acgcgaaaga aagataacga catcgaacgc gggaaacgcc agcaagaaat tttaaaagcg       720
     attttgaaga aagcgagcca ggcgagttcc attacaaaat acgacgatgt catcgaagcg       780
     gtcggaaaca acatgaaaac aaactttacg tttgaccaga taaaatctct tgtctattat       840
     gtcgtaagca acaaaaatct ctcgattgaa tcactccatc tcaccggaac agacagcaat       900
     gacggagttt attactacat gttagatgaa cagtctgttc aagaaatcag tgaaacgctc       960
     caaaatcatt tgcggtga                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page