(data stored in ACNUC7421 zone)

EMBL: CP002293.PE317

CP002293.PE317       Location/Qualifiers
FT   CDS_pept        369675..370382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0328"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG:
FT                   gwc:GWCH70_3040 late competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73173"
FT                   /db_xref="GOA:A0A0F6BIC2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIC2"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="ADP73173.1"
FT                   /translation="MNCLLCHTPYNPITSWQHFLTLKKADCLCAKCRNALLKIAGDICD
FT                   ICGRPSAGLKPSHQQKRLCADCIRWQADDEWKDVLTKNRSVYMYNDFMKEVVALWKFRG
FT                   DYAVVQAFQDEFCREFYRHFDNTFLIVPVPLSAERLFERGFNQAKALAELLALPIHELL
FT                   CRRHLEKQSKKSRLERLRTENVFRLSEQTSLQGKPIVLIDDIYTTGTTLRHAAKVLLKA
FT                   GAASVSSLTLARG"
     atgaattgtt tgctttgcca cacgccgtac aatccaatca caagctggca gcattttttg        60
     acgttaaaaa aagcggactg cctctgtgcg aaatgccgca atgctttgct gaaaattgcc       120
     ggagacattt gcgatatttg cggccggcct tccgcgggcc ttaaaccatc gcatcaacaa       180
     aagaggctat gcgctgattg catccgctgg caagcagacg atgaatggaa agatgtgtta       240
     acgaaaaacc gctcagtgta tatgtacaat gattttatga aggaagtggt tgcgctttgg       300
     aaatttcgcg gcgactacgc ggtggtccaa gcgtttcagg acgaattttg ccgcgagttt       360
     taccgccatt ttgacaatac ctttctgatc gtccctgttc ctctcagcgc cgagcgcctg       420
     ttcgaacgcg gctttaacca ggcaaaggcg ctcgccgagc tgcttgccct ccctattcat       480
     gagctgcttt gccgccgcca tttggaaaaa cagtccaaaa agtcgcgcct tgagcggctg       540
     cggaccgaaa acgtttttcg cctgtcggaa caaacatctt tgcagggcaa accgattgtg       600
     ttaatcgacg acatttatac gacagggacg acattaaggc atgcggcgaa ggtgttgctt       660
     aaggctggcg ctgcctctgt ttcttcgtta acattggcaa gaggttaa                    708
//

If you have problems or comments...

PBIL Back to PBIL home page