(data stored in ACNUC7421 zone)

EMBL: CP002293.PE320

CP002293.PE320       Location/Qualifiers
FT   CDS_pept        372613..373050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0331"
FT                   /product="protein of unknown function DUF327"
FT                   /note="PFAM: protein of unknown function DUF327; KEGG:
FT                   gwc:GWCH70_3035 protein of unknown function DUF327"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73176"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIC5"
FT                   /inference="protein motif:PFAM:PF03885"
FT                   /protein_id="ADP73176.1"
FT                   /translation="MEIRKITNANMVNVSKKEAAASPSVSFAEVAAKQNEELALERFRQ
FT                   LAKEIEEQGKKLAESSSVEDLRKYKRLVKKLLDDAVQNGLRLSEQHGFNWSGRSRLYKM
FT                   VKEVDKKLIDLTNAVLQKEKQGIDLLGTIGEIQGLIINIYT"
     gtggaaattc gaaaaatcac aaatgcgaac atggtgaatg taagcaaaaa agaagcagct        60
     gcttccccgt ctgtatcgtt tgcggaggtt gcggcaaagc aaaacgaaga actcgcgctc       120
     gaacgatttc gccagcttgc gaaagaaatc gaagaacaag gaaaaaaatt agcagaatcg       180
     agttcggtgg aagatttgcg aaaatataaa cggcttgtga aaaagctgct ggatgatgcg       240
     gtacaaaacg gtttgcgatt gtcagaacag catggtttca attggagcgg ccggtcgcgt       300
     ttgtacaaaa tggtgaaaga agtggataaa aagcttatcg atctcacgaa tgcggtgttg       360
     caaaaagaaa aacaaggaat cgacctttta ggcaccatcg gggaaattca agggttaatc       420
     atcaatattt atacgtaa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page