(data stored in ACNUC7421 zone)

EMBL: CP002293.PE321

CP002293.PE321       Location/Qualifiers
FT   CDS_pept        373104..373517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0332"
FT                   /product="Flagellar operon protein YvyF"
FT                   /note="TIGRFAM: Flagellar operon protein YvyF; KEGG:
FT                   afl:Aflv_2587 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73177"
FT                   /db_xref="InterPro:IPR022258"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIC6"
FT                   /inference="protein motif:TFAM:TIGR03826"
FT                   /protein_id="ADP73177.1"
FT                   /translation="MNLANCPNCGRLFVKTSFRDICEDCYKEEEEAFEKVYHFLRKREN
FT                   RMATMAQIVDATGVKESLLIKFIQSGRLKLAQFPNLTYPCARCGALIRQGKLCENCLKD
FT                   LNQQLEELQKEERKKRRQAENIYYTKRNDENKF"
     atgaatttag cgaattgccc aaactgcgga cgtttatttg ttaaaacttc gtttcgtgat        60
     atttgtgagg attgctataa agaggaagaa gaggcgtttg agaaagtcta ccattttttg       120
     cggaaaagag aaaaccgcat ggcgacaatg gcgcaaattg ttgacgcaac aggagtaaag       180
     gaatcgctgc tgattaaatt tattcaaagc ggccggctga aacttgcgca atttccaaat       240
     ctaacatacc cttgcgcccg ctgtggtgcg ttgattcgcc aaggcaagct ttgcgaaaac       300
     tgtttaaaag atttaaatca acagctagaa gagctgcaaa aagaagaaag gaaaaaacgc       360
     cgtcaggcag aaaacattta ttatacgaaa aggaacgatg aaaataaatt ttga             414
//

If you have problems or comments...

PBIL Back to PBIL home page