(data stored in SCRATCH zone)

EMBL: CP002293.PE322

CP002293.PE322       Location/Qualifiers
FT   CDS_pept        373609..373872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0333"
FT                   /product="Anti-sigma-28 factor FlgM family protein"
FT                   /note="KEGG: gwc:GWCH70_3033 anti-sigma-28 factor, FlgM;
FT                   TIGRFAM: Anti-sigma-28 factor FlgM family protein; PFAM:
FT                   Anti-sigma-28 factor FlgM family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73178"
FT                   /db_xref="GOA:A0A0F6BIC7"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIC7"
FT                   /inference="protein motif:TFAM:TIGR03824"
FT                   /protein_id="ADP73178.1"
FT                   /translation="MRIDKFGLPGINPYKRQFDKETQVKKNAIKQDKVEISAAAKELQQ
FT                   LSQWTVEHQEKVRKLKEQVQNGTYKIDAKEIAKSVYRFYFDN"
     atgagaattg acaaattcgg cctgccaggc attaatcctt ataaacggca atttgataaa        60
     gagacgcaag tgaaaaaaaa tgccattaaa caagataaag tggaaatttc cgcagcggcg       120
     aaagaactgc agcagctttc ccaatggacg gtcgaacatc aagaaaaagt gcgcaagtta       180
     aaggagcaag tgcaaaacgg gacatataaa attgacgcga aggaaattgc gaaaagtgta       240
     tatcgatttt attttgacaa ttaa                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page