(data stored in SCRATCH zone)

EMBL: CP002293.PE323

CP002293.PE323       Location/Qualifiers
FT   CDS_pept        373936..374418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0334"
FT                   /product="FlgN family protein"
FT                   /note="PFAM: FlgN family protein; KEGG: bsu:BSU35420
FT                   putative flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73179"
FT                   /db_xref="GOA:A0A0F6BIC8"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIC8"
FT                   /inference="protein motif:PFAM:PF05130"
FT                   /protein_id="ADP73179.1"
FT                   /translation="MSAKQLIELLENHVKLHKGLLELANKKTEVLKKGDTEALNEIVKE
FT                   EQKYIAAIGRVEQERIRVVHAMIGEADEPTLTACILQTEGTERAMLEKLQDDLSAVLSE
FT                   LKNVNQLNEQLAKQSLQFVHVMLNMLMPQPKEVNYRKPNVAPSSYEGGSSLFDSKA"
     ttgtctgcca aacaattaat agagctgttg gaaaaccatg tgaaactgca taaaggcttg        60
     ctggagctgg caaacaaaaa aacggaagtg ctaaaaaaag gcgatacgga agcactgaat       120
     gaaattgtga aagaagaaca aaaatatatt gcggccattg gccgtgttga gcaggaacgc       180
     attcgtgttg ttcacgcgat gatcggcgaa gcggacgaac cgacattaac agcgtgcatt       240
     ttgcaaacag aaggaacgga acgggccatg cttgagaaac tgcaggatga cttatctgcg       300
     gtgctgtcgg aattaaaaaa tgtgaaccaa ttaaacgagc agctggccaa gcaatcattg       360
     caatttgtcc atgtcatgct gaatatgctc atgccgcagc cgaaagaagt gaattaccgg       420
     aaaccgaacg tggcgccgtc ttcatatgaa ggcggaagtt cgctgtttga ttccaaagct       480
     tag                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page