(data stored in SCRATCH zone)

EMBL: CP002293.PE325

CP002293.PE325       Location/Qualifiers
FT   CDS_pept        376070..376966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0336"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="KEGG: gka:GK3136 flagellar hook-associated protein
FT                   FlgL; TIGRFAM: flagellar hook-associated protein 3; PFAM:
FT                   flagellin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73181"
FT                   /db_xref="GOA:A0A0F6BID0"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BID0"
FT                   /inference="protein motif:TFAM:TIGR02550"
FT                   /protein_id="ADP73181.1"
FT                   /translation="MRVTQFMLANNMLRNLSNSYERLGKYQEQLVTGKKISRPSDDPVV
FT                   AMKGIAYREDLARVKQYQRNIGEVHNWIDSADDALDKVGLALQRVQELVVQASTDTATP
FT                   EDRKKIADEIDQIQKHIVDVANTKVGGKYIFNGADTKNPLFIGYPDGMGGLGLNPNANT
FT                   SDVEIEVFDGIKLDVNIDGKTLFTGIIEMLDNLKTVLNDPNSTGNTISSHLSQVEAQQD
FT                   ALLAARSELGAKQNRVEMMENRLSTQEVIATKLMSNNEDIEYEKTITDLITQESVHRAA
FT                   LSVGARIIQPTLVDFLR"
     atgagggtta cacagtttat gctggcgaat aatatgctac gaaatttatc gaatagttat        60
     gagcggctcg gaaaatatca agaacagtta gtgacaggga agaaaatttc ccgcccttcc       120
     gatgatccag ttgtggcaat gaaagggata gcttatcggg aggatttagc gcgtgtaaag       180
     caatatcagc gcaacattgg agaagttcat aactggattg atagcgcaga tgacgcatta       240
     gataaagttg gacttgcttt gcaacgcgta caggaacttg ttgtccaagc atcaactgat       300
     acagctactc cagaagaccg caaaaaaatt gcggatgaaa ttgaccagat ccaaaagcac       360
     attgtcgatg tcgccaatac gaaagtcggt ggtaaatata tttttaacgg agccgatacg       420
     aaaaatcctt tgtttatagg atacccagat ggtatggggg gattagggct aaatccgaat       480
     gcaaatacaa gtgatgtcga aatcgaggtg tttgatggta ttaagttaga tgtcaatatt       540
     gatgggaaaa ctttatttac gggaattatc gagatgttag ataatttaaa gacggtttta       600
     aatgatccta acagtactgg aaacacaatt agcagccatt taagccaagt tgaagcgcaa       660
     caagacgcat tgttagcggc ccgttcggaa cttggggcga agcaaaatcg ggtcgagatg       720
     atggaaaacc gcttgtccac gcaagaagtg attgcgacaa aattaatgtc taacaacgaa       780
     gatatcgaat acgaaaaaac gattaccgat cttattacac aagagagcgt gcatcgcgct       840
     gctttaagcg tcggcgcgcg cattattcag cctacattgg ttgatttcct ccgttaa          897
//

If you have problems or comments...

PBIL Back to PBIL home page